Creatine kinase from Oryctolagus cuniculus (rabbit)

Enzyme Description

Species
Oryctolagus cuniculus (rabbit) β†—
Extremophile
No
EC Number
2.7.3.2 β†—

Sequence

Length: 381 amino acids
MPFGNTHNKYKLNYKSEEEYPDLSKHNNHMAKVLTPDLYKKLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYTVFKDLFDPIIQDRHGGFKPTDKHKTDLNHENLKGGDDLDPHYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDISNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
Wen-bin Ou et al. (2002) β€” Conformational changes and inactivation of rabbit muscle creatine kinase in dimethyl sulfoxide solutions
Biochemistry and Cell Biology  Β· doi:10.1139/o02-132 β†—  Β· Stability - Incubation
14 measurements ▼
Database ID
UniProt: P00563 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, eukaryote Oryctolagus cuniculus (rabbit)

Experimental Data (14 measurements)

14 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (4 hours at 25Β°C) measured by absorbance spectrophotometry (pH colorimetry method, thymol blue indicator abosrbance change by H+ released from reaction absorbance measurement, 597 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 2.5 % v/v 100 99 % Digital Continuous Incubation: 30 mM Tris-HCl, Assay: 5 mM Gly-NaOH buffer, 5 mM Mg2+, 0.01% Thymol Blue (w/v) Incubation: 8, Assay: 9 Incubation: 25Β°C, Assay: 25Β°C ATP (Adenosine triphosphate), 24 mM Creatine ADP , H+ , Phosphocreatine β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 25Β°C) measured by absorbance spectrophotometry (pH colorimetry method, thymol blue indicator abosrbance change by H+ released from reaction absorbance measurement, 597 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 5 % v/v 100 98 % Digital Continuous Incubation: 30 mM Tris-HCl, Assay: 5 mM Gly-NaOH buffer, 5 mM Mg2+, 0.01% Thymol Blue (w/v) Incubation: 8, Assay: 9 Incubation: 25Β°C, Assay: 25Β°C ATP (Adenosine triphosphate), 24 mM Creatine ADP , H+ , Phosphocreatine β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 25Β°C) measured by absorbance spectrophotometry (pH colorimetry method, thymol blue indicator abosrbance change by H+ released from reaction absorbance measurement, 597 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 20 % v/v 100 97 % Digital Continuous Incubation: 30 mM Tris-HCl, Assay: 5 mM Gly-NaOH buffer, 5 mM Mg2+, 0.01% Thymol Blue (w/v) Incubation: 8, Assay: 9 Incubation: 25Β°C, Assay: 25Β°C ATP (Adenosine triphosphate), 24 mM Creatine ADP , H+ , Phosphocreatine β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 25Β°C) measured by absorbance spectrophotometry (pH colorimetry method, thymol blue indicator abosrbance change by H+ released from reaction absorbance measurement, 597 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 30 % v/v 100 97 % Digital Continuous Incubation: 30 mM Tris-HCl, Assay: 5 mM Gly-NaOH buffer, 5 mM Mg2+, 0.01% Thymol Blue (w/v) Incubation: 8, Assay: 9 Incubation: 25Β°C, Assay: 25Β°C ATP (Adenosine triphosphate), 24 mM Creatine ADP , H+ , Phosphocreatine β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 25Β°C) measured by absorbance spectrophotometry (pH colorimetry method, thymol blue indicator abosrbance change by H+ released from reaction absorbance measurement, 597 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 40 % v/v 100 97 % Digital Continuous Incubation: 30 mM Tris-HCl, Assay: 5 mM Gly-NaOH buffer, 5 mM Mg2+, 0.01% Thymol Blue (w/v) Incubation: 8, Assay: 9 Incubation: 25Β°C, Assay: 25Β°C ATP (Adenosine triphosphate), 24 mM Creatine ADP , H+ , Phosphocreatine β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 25Β°C) measured by absorbance spectrophotometry (pH colorimetry method, thymol blue indicator abosrbance change by H+ released from reaction absorbance measurement, 597 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 50 % v/v 100 96 % Digital Continuous Incubation: 30 mM Tris-HCl, Assay: 5 mM Gly-NaOH buffer, 5 mM Mg2+, 0.01% Thymol Blue (w/v) Incubation: 8, Assay: 9 Incubation: 25Β°C, Assay: 25Β°C ATP (Adenosine triphosphate), 24 mM Creatine ADP , H+ , Phosphocreatine β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 25Β°C) measured by absorbance spectrophotometry (pH colorimetry method, thymol blue indicator abosrbance change by H+ released from reaction absorbance measurement, 597 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 60 % v/v 100 96 % Digital Continuous Incubation: 30 mM Tris-HCl, Assay: 5 mM Gly-NaOH buffer, 5 mM Mg2+, 0.01% Thymol Blue (w/v) Incubation: 8, Assay: 9 Incubation: 25Β°C, Assay: 25Β°C ATP (Adenosine triphosphate), 24 mM Creatine ADP , H+ , Phosphocreatine β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 25Β°C) measured by absorbance spectrophotometry (pH colorimetry method, thymol blue indicator abosrbance change by H+ released from reaction absorbance measurement, 597 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 65 % v/v 100 96 % Digital Continuous Incubation: 30 mM Tris-HCl, Assay: 5 mM Gly-NaOH buffer, 5 mM Mg2+, 0.01% Thymol Blue (w/v) Incubation: 8, Assay: 9 Incubation: 25Β°C, Assay: 25Β°C ATP (Adenosine triphosphate), 24 mM Creatine ADP , H+ , Phosphocreatine β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 25Β°C) measured by absorbance spectrophotometry (pH colorimetry method, thymol blue indicator abosrbance change by H+ released from reaction absorbance measurement, 597 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 70 % v/v 100 76 % Digital Continuous Incubation: 30 mM Tris-HCl, Assay: 5 mM Gly-NaOH buffer, 5 mM Mg2+, 0.01% Thymol Blue (w/v) Incubation: 8, Assay: 9 Incubation: 25Β°C, Assay: 25Β°C ATP (Adenosine triphosphate), 24 mM Creatine ADP , H+ , Phosphocreatine β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 25Β°C) measured by absorbance spectrophotometry (pH colorimetry method, thymol blue indicator abosrbance change by H+ released from reaction absorbance measurement, 597 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 71 % v/v 100 44 % Digital Continuous Incubation: 30 mM Tris-HCl, Assay: 5 mM Gly-NaOH buffer, 5 mM Mg2+, 0.01% Thymol Blue (w/v) Incubation: 8, Assay: 9 Incubation: 25Β°C, Assay: 25Β°C ATP (Adenosine triphosphate), 24 mM Creatine ADP , H+ , Phosphocreatine β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 25Β°C) measured by absorbance spectrophotometry (pH colorimetry method, thymol blue indicator abosrbance change by H+ released from reaction absorbance measurement, 597 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 72.5 % v/v 100 11 % Digital Continuous Incubation: 30 mM Tris-HCl, Assay: 5 mM Gly-NaOH buffer, 5 mM Mg2+, 0.01% Thymol Blue (w/v) Incubation: 8, Assay: 9 Incubation: 25Β°C, Assay: 25Β°C ATP (Adenosine triphosphate), 24 mM Creatine ADP , H+ , Phosphocreatine β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 25Β°C) measured by absorbance spectrophotometry (pH colorimetry method, thymol blue indicator abosrbance change by H+ released from reaction absorbance measurement, 597 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 75 % v/v 100 8 % Digital Continuous Incubation: 30 mM Tris-HCl, Assay: 5 mM Gly-NaOH buffer, 5 mM Mg2+, 0.01% Thymol Blue (w/v) Incubation: 8, Assay: 9 Incubation: 25Β°C, Assay: 25Β°C ATP (Adenosine triphosphate), 24 mM Creatine ADP , H+ , Phosphocreatine β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 25Β°C) measured by absorbance spectrophotometry (pH colorimetry method, thymol blue indicator abosrbance change by H+ released from reaction absorbance measurement, 597 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 80 % v/v 100 8 % Digital Continuous Incubation: 30 mM Tris-HCl, Assay: 5 mM Gly-NaOH buffer, 5 mM Mg2+, 0.01% Thymol Blue (w/v) Incubation: 8, Assay: 9 Incubation: 25Β°C, Assay: 25Β°C ATP (Adenosine triphosphate), 24 mM Creatine ADP , H+ , Phosphocreatine β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (4 hours at 25Β°C) measured by absorbance spectrophotometry (pH colorimetry method, thymol blue indicator abosrbance change by H+ released from reaction absorbance measurement, 597 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 90 % v/v 100 6 % Digital Continuous Incubation: 30 mM Tris-HCl, Assay: 5 mM Gly-NaOH buffer, 5 mM Mg2+, 0.01% Thymol Blue (w/v) Incubation: 8, Assay: 9 Incubation: 25Β°C, Assay: 25Β°C ATP (Adenosine triphosphate), 24 mM Creatine ADP , H+ , Phosphocreatine β€” β€” Non-incubated control (in %), assay in aqueous phase

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*