Pancreas lipase from Sus scrofa (pig)
Enzyme Description
Sequence
MLLIWTLSLLLGAVLGSEVCFPRLGCFSDDAPWAGIVQRPLKILPWDPKDVNTRFLLYTNENQDNYQELVADPSTITDSNFRMDRKTRFIIHGFIDKGEEDWLSNICKNLFKVESVNCICVDWKGGSRTGYTQASQNIRIVGAEVAYFVEVLKSSLGYSPSNVHVIGHSLGSHAAGEAGRRTNGTIERITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDAAPIIPNLGFGMSQVVGHLDFFPNGGKEMPGCQKNILSQIVDIDGIWEGTRDFVACNHLRSYKYYADSILNPDGFAGFPCDSYNVFTANKCFPCPSEGCPQMGHYADRFPGKTNGVSQVFYLNTGDASNFARWRYKVSVTLSGKKVTGHILVSLFGNEGNSRQYEIYKGTLQPDNTHSNEFDSDVEVGDLQKVKFIWYNNVINPTLPRVGASKITVERNDGKVYDFCSQETVREEVLLTLTPC
Li-Qiang Zhang et al. (2003)
β Lipase-Catalyzed Synthesis of Precursor Dipeptides of RGD in Aqueous Water-Miscible Organic Solvents
Preparative Biochemistry and Biotechnology
Β· doi:10.1081/PB-120018365 β
Β· Activity + Stability - Product Formation
▼
Database ID
UniProt: D4P6H2 β
Sequence Annotation
Inferred - from protein name
Protein Source
Commercially purchased
Experimental Data (20 measurements)
20 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity + Stability - Product Formation | Product yield after incubation in the presence of organic solvent, measured by HPLC | Acetonitrile | 50 % v/v | 5.0 | 59.8 | % | Direct | Continuous | 67 mM phosphate buffer | 8 | 15Β°C | 20 mM Benzyl-ArgOEt, 200 mM Gly-NH2 | Benzyl-Arg-Gly-NH2 , Ethanol | β | Yes, "stirring" | Classical aqueous control (in %) | Synthesis reaction |
| Activity + Stability - Product Formation | Product yield after incubation in the presence of organic solvent, measured by HPLC | Dimethyl Sulfoxide (DMSO) | 50 % v/v | 3.0 | 23.9 | % | Direct | Continuous | 67 mM phosphate buffer | 8 | 15Β°C | 200 mM Asp-NH2, 20 mM CBZ-Gly Nitrophenyl ester | CBZ-Gly-Asp-NH2 , p-Nitrophenol | β | Yes, "stirring" | Classical aqueous control (in %) | Synthesis reaction |
| Activity + Stability - Product Formation | Product yield after incubation in the presence of organic solvent, measured by HPLC | Dimethylformamide (DMF) | 50 % v/v | 3.0 | 50.2 | % | Direct | Continuous | 67 mM phosphate buffer | 8 | 15Β°C | 200 mM Asp-NH2, 20 mM CBZ-Gly Nitrophenyl ester | CBZ-Gly-Asp-NH2 , p-Nitrophenol | β | Yes, "stirring" | Classical aqueous control (in %) | Synthesis reaction |
| Activity + Stability - Product Formation | Product yield after incubation in the presence of organic solvent, measured by HPLC | Methanol | 50 % v/v | 3.0 | 67.8 | % | Direct | Continuous | 67 mM phosphate buffer | 8 | 15Β°C | 200 mM Asp-NH2, 20 mM CBZ-Gly Nitrophenyl ester | CBZ-Gly-Asp-NH2 , p-Nitrophenol | β | Yes, "stirring" | Classical aqueous control (in %) | Synthesis reaction |
| Activity + Stability - Product Formation | Product yield after incubation in the presence of organic solvent, measured by HPLC | Pyridine | 50 % v/v | 3.0 | 63.6 | % | Direct | Continuous | 67 mM phosphate buffer | 8 | 15Β°C | 200 mM Asp-NH2, 20 mM CBZ-Gly Nitrophenyl ester | CBZ-Gly-Asp-NH2 , p-Nitrophenol | β | Yes, "stirring" | Classical aqueous control (in %) | Synthesis reaction |
| Activity + Stability - Product Formation | Product yield after incubation in the presence of organic solvent, measured by HPLC | Acetonitrile | 50 % v/v | 3.0 | 12.7 | % | Direct | Continuous | 67 mM phosphate buffer | 8 | 15Β°C | 200 mM Asp-NH2, 20 mM CBZ-Gly Nitrophenyl ester | CBZ-Gly-Asp-NH2 , p-Nitrophenol | β | Yes, "stirring" | Classical aqueous control (in %) | Synthesis reaction |
| Activity + Stability - Product Formation | Product yield after incubation in the presence of organic solvent, measured by HPLC | Dimethyl Sulfoxide (DMSO) | 50 % v/v | 5.0 | 55.9 | % | Direct | Continuous | 67 mM phosphate buffer | 8 | 15Β°C | 20 mM Benzyl-ArgOEt, 200 mM Gly-NH2 | Benzyl-Arg-Gly-NH2 , Ethanol | β | Yes, "stirring" | Classical aqueous control (in %) | Synthesis reaction |
| Activity + Stability - Product Formation | Product yield after incubation in the presence of organic solvent, measured by HPLC | Dimethylformamide (DMF) | 50 % v/v | 5.0 | 73.6 | % | Direct | Continuous | 67 mM phosphate buffer | 8 | 15Β°C | 20 mM Benzyl-ArgOEt, 200 mM Gly-NH2 | Benzyl-Arg-Gly-NH2 , Ethanol | β | Yes, "stirring" | Classical aqueous control (in %) | Synthesis reaction |
| Activity + Stability - Product Formation | Product yield after incubation in the presence of organic solvent, measured by HPLC | Methanol | 50 % v/v | 5.0 | 71.4 | % | Direct | Continuous | 67 mM phosphate buffer | 8 | 15Β°C | 20 mM Benzyl-ArgOEt, 200 mM Gly-NH2 | Benzyl-Arg-Gly-NH2 , Ethanol | β | Yes, "stirring" | Classical aqueous control (in %) | Synthesis reaction |
| Activity + Stability - Product Formation | Product yield after incubation in the presence of organic solvent, measured by HPLC | Pyridine | 50 % v/v | 5.0 | 64.8 | % | Direct | Continuous | 67 mM phosphate buffer | 8 | 15Β°C | 20 mM Benzyl-ArgOEt, 200 mM Gly-NH2 | Benzyl-Arg-Gly-NH2 , Ethanol | β | Yes, "stirring" | Classical aqueous control (in %) | Synthesis reaction |
| Activity + Stability - Product Formation | Product yield after incubation in the presence of organic solvent, measured by HPLC | Methanol | 30 % v/v | 5.0 | 58.0 | % | Digital | Continuous | 67 mM phosphate buffer | 8 | 15Β°C | 20 mM Benzyl-ArgOEt, 200 mM Gly-NH2 | Benzyl-Arg-Gly-NH2 , Ethanol | β | Yes, "stirring" | Classical aqueous control (in %) | Synthesis reaction |
| Activity + Stability - Product Formation | Product yield after incubation in the presence of organic solvent, measured by HPLC | Methanol | 100 % v/v | 3.0 | 3.0 | % | Digital | Continuous | 67 mM phosphate buffer | 8 | 15Β°C | 200 mM Asp-NH2, 20 mM CBZ-Gly Nitrophenyl ester | CBZ-Gly-Asp-NH2 , p-Nitrophenol | β | Yes, "stirring" | Classical aqueous control (in %) | Synthesis reaction |
| Activity + Stability - Product Formation | Product yield after incubation in the presence of organic solvent, measured by HPLC | Methanol | 80 % v/v | 3.0 | 45.0 | % | Digital | Continuous | 67 mM phosphate buffer | 8 | 15Β°C | 200 mM Asp-NH2, 20 mM CBZ-Gly Nitrophenyl ester | CBZ-Gly-Asp-NH2 , p-Nitrophenol | β | Yes, "stirring" | Classical aqueous control (in %) | Synthesis reaction |
| Activity + Stability - Product Formation | Product yield after incubation in the presence of organic solvent, measured by HPLC | Methanol | 50 % v/v | 3.0 | 58.0 | % | Digital | Continuous | 67 mM phosphate buffer | 8 | 15Β°C | 200 mM Asp-NH2, 20 mM CBZ-Gly Nitrophenyl ester | CBZ-Gly-Asp-NH2 , p-Nitrophenol | β | Yes, "stirring" | Classical aqueous control (in %) | Synthesis reaction |
| Activity + Stability - Product Formation | Product yield after incubation in the presence of organic solvent, measured by HPLC | Methanol | 40 % v/v | 3.0 | 67.0 | % | Digital | Continuous | 67 mM phosphate buffer | 8 | 15Β°C | 200 mM Asp-NH2, 20 mM CBZ-Gly Nitrophenyl ester | CBZ-Gly-Asp-NH2 , p-Nitrophenol | β | Yes, "stirring" | Classical aqueous control (in %) | Synthesis reaction |
| Activity + Stability - Product Formation | Product yield after incubation in the presence of organic solvent, measured by HPLC | Methanol | 30 % v/v | 3.0 | 40.0 | % | Digital | Continuous | 67 mM phosphate buffer | 8 | 15Β°C | 200 mM Asp-NH2, 20 mM CBZ-Gly Nitrophenyl ester | CBZ-Gly-Asp-NH2 , p-Nitrophenol | β | Yes, "stirring" | Classical aqueous control (in %) | Synthesis reaction |
| Activity + Stability - Product Formation | Product yield after incubation in the presence of organic solvent, measured by HPLC | Methanol | 100 % v/v | 5.0 | 0.0 | % | Digital | Continuous | 67 mM phosphate buffer | 8 | 15Β°C | 20 mM Benzyl-ArgOEt, 200 mM Gly-NH2 | Benzyl-Arg-Gly-NH2 , Ethanol | β | Yes, "stirring" | Classical aqueous control (in %) | Synthesis reaction |
| Activity + Stability - Product Formation | Product yield after incubation in the presence of organic solvent, measured by HPLC | Methanol | 80 % v/v | 5.0 | 15.0 | % | Digital | Continuous | 67 mM phosphate buffer | 8 | 15Β°C | 20 mM Benzyl-ArgOEt, 200 mM Gly-NH2 | Benzyl-Arg-Gly-NH2 , Ethanol | β | Yes, "stirring" | Classical aqueous control (in %) | Synthesis reaction |
| Activity + Stability - Product Formation | Product yield after incubation in the presence of organic solvent, measured by HPLC | Methanol | 50 % v/v | 5.0 | 72.0 | % | Digital | Continuous | 67 mM phosphate buffer | 8 | 15Β°C | 20 mM Benzyl-ArgOEt, 200 mM Gly-NH2 | Benzyl-Arg-Gly-NH2 , Ethanol | β | Yes, "stirring" | Classical aqueous control (in %) | Synthesis reaction |
| Activity + Stability - Product Formation | Product yield after incubation in the presence of organic solvent, measured by HPLC | Methanol | 40 % v/v | 5.0 | 69.0 | % | Digital | Continuous | 67 mM phosphate buffer | 8 | 15Β°C | 20 mM Benzyl-ArgOEt, 200 mM Gly-NH2 | Benzyl-Arg-Gly-NH2 , Ethanol | β | Yes, "stirring" | Classical aqueous control (in %) | Synthesis reaction |
Visualization : Activity + Stability β Product Formation
One bar per measurement. Colour = solvent, shade = solvent volume.