Purified protease from Oceanobacillus iheyensis

Enzyme Description

Extremophile
Yes "haloalkaliphilic" organism
EC Number

Sequence

Length: 135 amino acids
MNPGSAWRSPVVPFSSLGMSPAYGTQLADDRRHPHRRGVILYVLGWAVSGRPVGNPQASVKNTAPTDRLATATLKVSKLPAFHVRPIDLEDPARALAPASTSSDTGINIYTASGGSTAKDGELRHSHSPLVVSRR
Megha K. Purohit et al. (2022) β€” Comparative analysis of the catalysis and stability of the native, recombinant and metagenomic alkaline proteases in organic solvents
Environmental Science and Pollution Research  Β· doi:10.1007/s11356-022-21411-7 β†—  Β· Activity - Classical Stability - Incubation
42 measurements
Database ID
UniProt: E3UEQ6 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Purified, bacterium extremophilic halophile Oceanobacillus iheyensis

Experimental Data (42 measurements)

42 measurements β€” page 1 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Methanol 10 % v/v 100.0 65.4 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Xylene 30 % v/v 100.0 20.7 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Xylene 20 % v/v 100.0 29.9 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Xylene 10 % v/v 100.0 57.2 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Xylene 5 % v/v 100.0 78.5 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent n-Hexane 30 % v/v 100.0 18.6 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent n-Hexane 20 % v/v 100.0 34.9 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent n-Hexane 10 % v/v 100.0 69.6 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent n-Hexane 5 % v/v 100.0 80.8 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Chloroform 30 % v/v 100.0 0.0 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Chloroform 20 % v/v 100.0 35.4 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Chloroform 10 % v/v 100.0 52.0 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Acetone 30 % v/v 100.0 0.0 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Chloroform 5 % v/v 100.0 66.4 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Methanol 5 % v/v 100.0 73.0 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Methanol 20 % v/v 100.0 24.1 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Methanol 30 % v/v 100.0 16.3 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Glycerol 5 % v/v 100.0 68.8 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Glycerol 10 % v/v 100.0 53.0 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Glycerol 20 % v/v 100.0 20.2 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
β€Ή Prev
1 2 3

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*