Recombinant protease from Oceanobacillus iheyensis

Enzyme Description

Species
Oceanobacillus iheyensis β†—
Extremophile
Yes "haloalkaliphilic" organism
EC Number
3.4.- β†—

Sequence

Length: 135 amino acids
MNPGSAWRSPVVPFSSLGMSPAYGTQLADDRRHPHRRGVILYVLGWAVSGRPVGNPQASVKNTAPTDRLATATLKVSKLPAFHVRPIDLEDPARALAPASTSSDTGINIYTASGGSTAKDGELRHSHSPLVVSRR
Megha K. Purohit et al. (2022) β€” Comparative analysis of the catalysis and stability of the native, recombinant and metagenomic alkaline proteases in organic solvents
Environmental Science and Pollution Research  Β· doi:10.1007/s11356-022-21411-7 β†—  Β· Activity - Classical Stability - Incubation
42 measurements ▼
Database ID
UniProt: E3UEQ6 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli

Experimental Data (42 measurements)

42 measurements β€” page 1 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Methanol 10 % v/v 100.0 15.7 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Xylene 30 % v/v 100.0 0.0 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Xylene 20 % v/v 100.0 23.9 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Xylene 10 % v/v 100.0 46.4 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Xylene 5 % v/v 100.0 60.4 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent n-Hexane 30 % v/v 100.0 0.0 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent n-Hexane 20 % v/v 100.0 43.6 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent n-Hexane 10 % v/v 100.0 54.8 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent n-Hexane 5 % v/v 100.0 65.1 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Chloroform 30 % v/v 100.0 0.0 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Chloroform 20 % v/v 100.0 6.0 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Chloroform 10 % v/v 100.0 10.2 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Acetone 30 % v/v 100.0 0.0 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Chloroform 5 % v/v 100.0 29.9 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Methanol 5 % v/v 100.0 38.3 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Methanol 20 % v/v 100.0 8.4 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Methanol 30 % v/v 100.0 0.0 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Glycerol 5 % v/v 100.0 30.7 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Glycerol 10 % v/v 100.0 11.8 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent Glycerol 20 % v/v 100.0 0.0 % Digital Continuous 20 mM NaOH Borax buffer 10 60Β°C 0.005 Casein free amino acids , Peptides β€” β€” Classical aqueous control (in %)
β€Ή Prev
1 2 3
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*