Recombinant protease from Oceanobacillus iheyensis
Enzyme Description
Species
Extremophile
Yes
"haloalkaliphilic" organism
EC Number
Sequence
MNPGSAWRSPVVPFSSLGMSPAYGTQLADDRRHPHRRGVILYVLGWAVSGRPVGNPQASVKNTAPTDRLATATLKVSKLPAFHVRPIDLEDPARALAPASTSSDTGINIYTASGGSTAKDGELRHSHSPLVVSRR
Megha K. Purohit et al. (2022)
β Comparative analysis of the catalysis and stability of the native, recombinant and metagenomic alkaline proteases in organic solvents
Environmental Science and Pollution Research
Β· doi:10.1007/s11356-022-21411-7 β
Β· Activity - Classical Stability - Incubation
▼
Database ID
UniProt: E3UEQ6 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli
Experimental Data (42 measurements)
42 measurements β page 1 of 3
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | Methanol | 10 % v/v | 100.0 | 15.7 | % | Digital | Continuous | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.005 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | Xylene | 30 % v/v | 100.0 | 0.0 | % | Digital | Continuous | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.005 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | Xylene | 20 % v/v | 100.0 | 23.9 | % | Digital | Continuous | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.005 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | Xylene | 10 % v/v | 100.0 | 46.4 | % | Digital | Continuous | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.005 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | Xylene | 5 % v/v | 100.0 | 60.4 | % | Digital | Continuous | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.005 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | n-Hexane | 30 % v/v | 100.0 | 0.0 | % | Digital | Continuous | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.005 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | n-Hexane | 20 % v/v | 100.0 | 43.6 | % | Digital | Continuous | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.005 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | n-Hexane | 10 % v/v | 100.0 | 54.8 | % | Digital | Continuous | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.005 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | n-Hexane | 5 % v/v | 100.0 | 65.1 | % | Digital | Continuous | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.005 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | Chloroform | 30 % v/v | 100.0 | 0.0 | % | Digital | Continuous | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.005 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | Chloroform | 20 % v/v | 100.0 | 6.0 | % | Digital | Continuous | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.005 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | Chloroform | 10 % v/v | 100.0 | 10.2 | % | Digital | Continuous | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.005 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | Acetone | 30 % v/v | 100.0 | 0.0 | % | Digital | Continuous | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.005 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | Chloroform | 5 % v/v | 100.0 | 29.9 | % | Digital | Continuous | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.005 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | Methanol | 5 % v/v | 100.0 | 38.3 | % | Digital | Continuous | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.005 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | Methanol | 20 % v/v | 100.0 | 8.4 | % | Digital | Continuous | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.005 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | Methanol | 30 % v/v | 100.0 | 0.0 | % | Digital | Continuous | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.005 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | Glycerol | 5 % v/v | 100.0 | 30.7 | % | Digital | Continuous | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.005 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | Glycerol | 10 % v/v | 100.0 | 11.8 | % | Digital | Continuous | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.005 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in the presence of organic solvent | Glycerol | 20 % v/v | 100.0 | 0.0 | % | Digital | Continuous | 20 mM NaOH Borax buffer | 10 | 60Β°C | 0.005 Casein | free amino acids , Peptides | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.