N-terminal truncated lipolytic enzyme (gene PanLipΞN) from Pseudonocardia antarctica
Enzyme Description
Species
Extremophile
Yes
"psychrophilic" organism
EC Number
Sequence
GPALSVPPDQLDAAVRCSANATDADRDVALFVPGTTLTPEVNFGFNWFAALDDLGRPYCSVTLPNNAMTDTQIAAEYVVHAI RHVHGISGRKVDVLGHSQGGTEPRFALRFWPDLRGMVDDYVAFGTTNHGSIAINAALCTPATGCAEALWQQTLNSH YTQAMNSYQETFAGISYTQIYTRTDEFVQPNLDDSGTTSLHGGGGEISNVALQDVCLTEAASEHIAVGTYSPVAYALATDALDHDGPADPARVDRGVCTQVFMPGVDPLTFPTDYAATLGLIANQLALAPRVGSEPELRPYTLADDRQG
Lixiao Liu et al. (2025)
β A CALB-like Cold-Active Lipolytic Enzyme from Pseudonocardia antarctica: Expression, Biochemical Characterization, and AlphaFold-Guided Dynamics
Marine Drugs
Β· doi:10.3390/md23120480 β
Β· Stability - Incubation
▼
Database ID
β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (18 measurements)
18 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | n-Hexane | 10 % v/v | 100 | 62 | % | Digital | Continuous | Incubation: ?, Assay: 200 mM TrisβHCl, 100 mM NaCl | Incubation: ?, Assay: 7.4 | Incubation: 25Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name |
| Stability - Incubation | Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 3 % v/v | 100 | 55 | % | Digital | Continuous | Incubation: ?, Assay: 200 mM TrisβHCl, 100 mM NaCl | Incubation: ?, Assay: 7.4 | Incubation: 25Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name |
| Stability - Incubation | Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 2 % v/v | 100 | 103 | % | Digital | Continuous | Incubation: ?, Assay: 200 mM TrisβHCl, 100 mM NaCl | Incubation: ?, Assay: 7.4 | Incubation: 25Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name |
| Stability - Incubation | Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 1 % v/v | 100 | 105 | % | Digital | Continuous | Incubation: ?, Assay: 200 mM TrisβHCl, 100 mM NaCl | Incubation: ?, Assay: 7.4 | Incubation: 25Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name |
| Stability - Incubation | Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 50 % v/v | 100 | 8 | % | Digital | Continuous | Incubation: ?, Assay: 200 mM TrisβHCl, 100 mM NaCl | Incubation: ?, Assay: 7.4 | Incubation: 25Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name |
| Stability - Incubation | Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 25 % v/v | 100 | 45 | % | Digital | Continuous | Incubation: ?, Assay: 200 mM TrisβHCl, 100 mM NaCl | Incubation: ?, Assay: 7.4 | Incubation: 25Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name |
| Stability - Incubation | Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 10 % v/v | 100 | 89 | % | Digital | Continuous | Incubation: ?, Assay: 200 mM TrisβHCl, 100 mM NaCl | Incubation: ?, Assay: 7.4 | Incubation: 25Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name |
| Stability - Incubation | Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | n-Hexane | 50 % v/v | 100 | 110 | % | Digital | Continuous | Incubation: ?, Assay: 200 mM TrisβHCl, 100 mM NaCl | Incubation: ?, Assay: 7.4 | Incubation: 25Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name |
| Stability - Incubation | Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | n-Hexane | 25 % v/v | 100 | 92 | % | Digital | Continuous | Incubation: ?, Assay: 200 mM TrisβHCl, 100 mM NaCl | Incubation: ?, Assay: 7.4 | Incubation: 25Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name |
| Stability - Incubation | Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 10 % v/v | 100 | 80 | % | Digital | Continuous | Incubation: ?, Assay: 200 mM TrisβHCl, 100 mM NaCl | Incubation: ?, Assay: 7.4 | Incubation: 25Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name |
| Stability - Incubation | Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 50 % v/v | 100 | 104 | % | Digital | Continuous | Incubation: ?, Assay: 200 mM TrisβHCl, 100 mM NaCl | Incubation: ?, Assay: 7.4 | Incubation: 25Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name |
| Stability - Incubation | Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 25 % v/v | 100 | 92 | % | Digital | Continuous | Incubation: ?, Assay: 200 mM TrisβHCl, 100 mM NaCl | Incubation: ?, Assay: 7.4 | Incubation: 25Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name |
| Stability - Incubation | Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Isopropanol | 10 % v/v | 100 | 72 | % | Digital | Continuous | Incubation: ?, Assay: 200 mM TrisβHCl, 100 mM NaCl | Incubation: ?, Assay: 7.4 | Incubation: 25Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name |
| Stability - Incubation | Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 50 % v/v | 100 | 31 | % | Digital | Continuous | Incubation: ?, Assay: 200 mM TrisβHCl, 100 mM NaCl | Incubation: ?, Assay: 7.4 | Incubation: 25Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name |
| Stability - Incubation | Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 25 % v/v | 100 | 82 | % | Digital | Continuous | Incubation: ?, Assay: 200 mM TrisβHCl, 100 mM NaCl | Incubation: ?, Assay: 7.4 | Incubation: 25Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name |
| Stability - Incubation | Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 10 % v/v | 100 | 72 | % | Digital | Continuous | Incubation: ?, Assay: 200 mM TrisβHCl, 100 mM NaCl | Incubation: ?, Assay: 7.4 | Incubation: 25Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name |
| Stability - Incubation | Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 50 % v/v | 100 | 31 | % | Digital | Continuous | Incubation: ?, Assay: 200 mM TrisβHCl, 100 mM NaCl | Incubation: ?, Assay: 7.4 | Incubation: 25Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name |
| Stability - Incubation | Activity after incubation ( ? minutes at 25Β°C) measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 25 % v/v | 100 | 110 | % | Digital | Continuous | Incubation: ?, Assay: 200 mM TrisβHCl, 100 mM NaCl | Incubation: ?, Assay: 7.4 | Incubation: 25Β°C, Assay: 25Β°C | 1 mM p-Nitrophenyl acetate | Acetic Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about assay in aqueous phase, annotation as esterase given the enzyme specificty despite its name |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.