Alcohol dehydrogenase from Thermoanaerobacter brockii
Enzyme Description
Sequence
MKGFAMLSIGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEAVGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKFSNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHGAELADIELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIMNLTEGKGVDAAIIAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLEWGCGMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLVTHVFRGFDNIEKAFMLMKDKPKDLIKPVVILA
Murillo Villela Filho et al. (2003)
β Is log P a Convenient Criterion to Guide the Choice of Solvents for Biphasic Enzymatic Reactions?
Angewandte Chemie International Edition
Β· doi:10.1002/anie.200351089 β
Β· Stability - Half-life
▼
Database ID
UniProt: P14941 β
Sequence Annotation
Inferred - from protein name
Protein Source
Commercially purchased
Experimental Data (10 measurements)
10 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Half-life | Half-life (in hours) in organic solvent, likely measured by absorbance spectrophotometry (NADH absorbance measurement) in aqueous phase | tert-Butanol | 50 % v/v | 480 | 376 | hours | Digital | Continuous | Incubation: Phosphate buffer, Assay: Phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 30Β°C | 10 mM Acetophenone | 1-Phenylethanol | Assay: 0.2 mM NADPH | Yes, incubation "stirred continuously" | Classical aqueous control (in hours) | Deducted assay method |
| Stability - Half-life | Half-life (in hours) in organic solvent, likely measured by absorbance spectrophotometry (NADH absorbance measurement) in aqueous phase | Ethyl Acetate | 50 % v/v | 480 | 24 | hours | Digital | Continuous | Incubation: Phosphate buffer, Assay: Phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 30Β°C | 10 mM Acetophenone | 1-Phenylethanol | Assay: 0.2 mM NADPH | Yes, incubation "stirred continuously" | Classical aqueous control (in hours) | Deducted assay method |
| Stability - Half-life | Half-life (in hours) in organic solvent, likely measured by absorbance spectrophotometry (NADH absorbance measurement) in aqueous phase | Diethyl Ether | 50 % v/v | 480 | 562 | hours | Digital | Continuous | Incubation: Phosphate buffer, Assay: Phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 30Β°C | 10 mM Acetophenone | 1-Phenylethanol | Assay: 0.2 mM NADPH | Yes, incubation "stirred continuously" | Classical aqueous control (in hours) | Deducted assay method |
| Stability - Half-life | Half-life (in hours) in organic solvent, likely measured by absorbance spectrophotometry (NADH absorbance measurement) in aqueous phase | tert-Butyl Methyl Ether (MTBE) | 50 % v/v | 480 | 1884 | hours | Digital | Continuous | Incubation: Phosphate buffer, Assay: Phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 30Β°C | 10 mM Acetophenone | 1-Phenylethanol | Assay: 0.2 mM NADPH | Yes, incubation "stirred continuously" | Classical aqueous control (in hours) | Deducted assay method |
| Stability - Half-life | Half-life (in hours) in organic solvent, likely measured by absorbance spectrophotometry (NADH absorbance measurement) in aqueous phase | Dichloromethane | 50 % v/v | 480 | 1 | hours | Digital | Continuous | Incubation: Phosphate buffer, Assay: Phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 30Β°C | 10 mM Acetophenone | 1-Phenylethanol | Assay: 0.2 mM NADPH | Yes, incubation "stirred continuously" | Classical aqueous control (in hours) | Deducted assay method |
| Stability - Half-life | Half-life (in hours) in organic solvent, likely measured by absorbance spectrophotometry (NADH absorbance measurement) in aqueous phase | Diisopropyl Ether | 50 % v/v | 480 | 668 | hours | Digital | Continuous | Incubation: Phosphate buffer, Assay: Phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 30Β°C | 10 mM Acetophenone | 1-Phenylethanol | Assay: 0.2 mM NADPH | Yes, incubation "stirred continuously" | Classical aqueous control (in hours) | Deducted assay method |
| Stability - Half-life | Half-life (in hours) in organic solvent, likely measured by absorbance spectrophotometry (NADH absorbance measurement) in aqueous phase | Toluene | 50 % v/v | 480 | 7 | hours | Digital | Continuous | Incubation: Phosphate buffer, Assay: Phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 30Β°C | 10 mM Acetophenone | 1-Phenylethanol | Assay: 0.2 mM NADPH | Yes, incubation "stirred continuously" | Classical aqueous control (in hours) | Deducted assay method |
| Stability - Half-life | Half-life (in hours) in organic solvent, likely measured by absorbance spectrophotometry (NADH absorbance measurement) in aqueous phase | Butyl Ether | 50 % v/v | 480 | 5 | hours | Digital | Continuous | Incubation: Phosphate buffer, Assay: Phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 30Β°C | 10 mM Acetophenone | 1-Phenylethanol | Assay: 0.2 mM NADPH | Yes, incubation "stirred continuously" | Classical aqueous control (in hours) | Deducted assay method |
| Stability - Half-life | Half-life (in hours) in organic solvent, likely measured by absorbance spectrophotometry (NADH absorbance measurement) in aqueous phase | Cyclohexane | 50 % v/v | 480 | 8 | hours | Digital | Continuous | Incubation: Phosphate buffer, Assay: Phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 30Β°C | 10 mM Acetophenone | 1-Phenylethanol | Assay: 0.2 mM NADPH | Yes, incubation "stirred continuously" | Classical aqueous control (in hours) | Deducted assay method |
| Stability - Half-life | Half-life (in hours) in organic solvent, likely measured by absorbance spectrophotometry (NADH absorbance measurement) in aqueous phase | n-Nonane | 50 % v/v | 480 | 1 | hours | Digital | Continuous | Incubation: Phosphate buffer, Assay: Phosphate buffer | Incubation: 7, Assay: 7 | Incubation: 4Β°C, Assay: 30Β°C | 10 mM Acetophenone | 1-Phenylethanol | Assay: 0.2 mM NADPH | Yes, incubation "stirred continuously" | Classical aqueous control (in hours) | Deducted assay method |
Visualization : Stability β Half-life
One bar per measurement. Colour = solvent, shade = solvent volume.