UDP-glucuronosyltransferase 2B17 from Homo sapiens

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 530 amino acids
MSLKWMSVFLLMQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVIVLTSSASILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEYSDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYTVEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATMIFMITKCCLFCFRKLAKTGKKKKRD
Verawan Uchaipichat et al. (2004) β€” Human udp-glucuronosyltransferases: isoform selectivity and kinetics of 4-methylumbelliferone and 1-naphthol glucuronidation, effects of organic solvents, and inhibition by diclofenac and probenecid
Drug Metabolism and Disposition  Β· doi:10.1124/dmd.32.4.413 β†—  Β· Activity - Classical
12 measurements
Database ID
UniProt: O75795 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host human HEK293 cells

Experimental Data (12 measurements)

12 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent Methanol 0.5 % v/v 100 81 % Digital Continuous 0.1 M phosphate buffer, 5 mM MgClβ‚‚ 7.4 37Β°C 3400 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt 4-methylumbelliferone glucuronide , UDP β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent Methanol 1 % v/v 100 76 % Digital Continuous 0.1 M phosphate buffer, 5 mM MgClβ‚‚ 7.4 37Β°C 3400 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt 4-methylumbelliferone glucuronide , UDP β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent Methanol 2 % v/v 100 65 % Digital Continuous 0.1 M phosphate buffer, 5 mM MgClβ‚‚ 7.4 37Β°C 3400 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt 4-methylumbelliferone glucuronide , UDP β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent Methanol 4 % v/v 100 55 % Digital Continuous 0.1 M phosphate buffer, 5 mM MgClβ‚‚ 7.4 37Β°C 3400 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt 4-methylumbelliferone glucuronide , UDP β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent Acetone 0.5 % v/v 100 70 % Digital Continuous 0.1 M phosphate buffer, 5 mM MgClβ‚‚ 7.4 37Β°C 3400 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt 4-methylumbelliferone glucuronide , UDP β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent Acetone 1 % v/v 100 59 % Digital Continuous 0.1 M phosphate buffer, 5 mM MgClβ‚‚ 7.4 37Β°C 3400 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt 4-methylumbelliferone glucuronide , UDP β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 0.5 % v/v 100 51 % Digital Continuous 0.1 M phosphate buffer, 5 mM MgClβ‚‚ 7.4 37Β°C 3400 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt 4-methylumbelliferone glucuronide , UDP β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 1 % v/v 100 32 % Digital Continuous 0.1 M phosphate buffer, 5 mM MgClβ‚‚ 7.4 37Β°C 3400 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt 4-methylumbelliferone glucuronide , UDP β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent Acetonitrile 0.5 % v/v 100 84 % Digital Continuous 0.1 M phosphate buffer, 5 mM MgClβ‚‚ 7.4 37Β°C 3400 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt 4-methylumbelliferone glucuronide , UDP β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent Acetonitrile 1 % v/v 100 69 % Digital Continuous 0.1 M phosphate buffer, 5 mM MgClβ‚‚ 7.4 37Β°C 3400 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt 4-methylumbelliferone glucuronide , UDP β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent Ethanol 0.5 % v/v 100 63 % Digital Continuous 0.1 M phosphate buffer, 5 mM MgClβ‚‚ 7.4 37Β°C 3400 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt 4-methylumbelliferone glucuronide , UDP β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by fluorescence spectrophotometry (4-methylumbelliferone glucuronide fluorescence measurement, excitation at 315 nm, absorbance measurement at 365 nm) in the presence of organic solvent Ethanol 1 % v/v 100 44 % Digital Continuous 0.1 M phosphate buffer, 5 mM MgClβ‚‚ 7.4 37Β°C 3400 Β΅M 4-Methylumbelliferyl Ξ²-D-glucuronide, 5 mM Uridine 5'-diphosphoglucuronic acid trisodium salt 4-methylumbelliferone glucuronide , UDP β€” β€” Classical aqueous control (in %)

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*