Fructose bisphosphate aldolase from Edwardsiella ictaluri

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 357 amino acids
SKIFDFVKPGVIFGDDVQKVFQVAKENKFALPAVNCVGTDSINAVMEAAAKVRAPIIVQFSNGGAAFIAGKGLKLEGQQGAILGAIAGAHHVHQMAEYYGVPVILHTDHCAKKLLPWLDGLLDAGEKHFAATGKPLFSSHMIDLSEESLEENIEICSQYLARMSKIGMTLELELGCTGGEEDGVDNSHLDNSALYTQPEDVDYAFTKLSAISPRFTIAASFGNVHGVYKPGNVQLTPVILKNSQEYVSKKHNLPHNSLNFVFHGGSGSTAAEIKEAVSYGVVKMNIDTDTQWATWEGVLKYYKKNEGYLQGQLGNPEGDDKPNKKYYDPRVWLRAAQTGMIERLEQAFKELNCIDVL
J. Hao et al. (2004) β€” A thermostable variant of fructose bisphosphate aldolase constructed by directed evolution also shows increased stability in organic solvents
Protein Engineering Design and Selection  Β· doi:10.1093/protein/gzh081 β†—  Β· Stability - Incubation Activity + Stability - Incubation
24 measurements
Database ID
UniProt: O52402 β†—
Sequence Annotation
Explicit - Provided (first residue from UniProt sequence absent from the mature protein)
Protein Source
Recombinant, host bacterium Escherichia coli KM3

Experimental Data (24 measurements)

24 measurements β€” page 2 of 2
Mutation Property Assay Solvent Solvent Volume Aqueous ReferenceWT Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
V45A/K71I/Q79L/A111T/A124V/A210V/Q346R Stability - Incubation Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase Dimethylformamide (DMF) 20 % v/v 96 20 102 % Digital Continuous Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 4 mM Fructose 1,6-biphosphate Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate β€” β€” Water-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase
V45A/K71I/Q79L/A111T/A124V/A210V/Q346R Stability - Incubation Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase Acetonitrile 20 % v/v 96 7 89 % Digital Continuous Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 4 mM Fructose 1,6-biphosphate Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate β€” β€” Water-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase
V45A/K71I/Q79L/A111T/A124V/A210V/Q346R Stability - Incubation Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase Chloroform 20 % v/v 96 50 97 % Digital Continuous Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 4 mM Fructose 1,6-biphosphate Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate β€” β€” Water-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase
V45A/K71I/Q79L/A111T/A124V/A210V/Q346R Stability - Incubation Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase Methanol 20 % v/v 96 50 103 % Digital Continuous Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate Incubation: 8, Assay: 8 Incubation: Room temperature, Assay: 30Β°C 4 mM Fructose 1,6-biphosphate Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate β€” β€” Water-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase
1 2
Next β€Ί

Mutations in this dataset (2)

WT V45A/K71I/Q79L/A111T/A124V/A210V/Q346R

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume. β€” β€” β€” Reference value. Hover for details.

Mutation Effect

Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume. β€” β€” β€” Reference value. Hover for details.

Mutation Effect

Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*