Fructose bisphosphate aldolase from Escherichia coli
Enzyme Description
Sequence
SKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTGGEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL
J. Hao et al. (2004)
β A thermostable variant of fructose bisphosphate aldolase constructed by directed evolution also shows increased stability in organic solvents
Protein Engineering Design and Selection
Β· doi:10.1093/protein/gzh081 β
Β· Stability - Incubation Activity + Stability - Incubation
▼
Database ID
UniProt: P0AB71 β
Sequence Annotation
Explicit - Provided (first residue from UniProt sequence absent from the mature protein)
Protein Source
Recombinant, host bacterium Escherichia coli KM3
Experimental Data (12 measurements)
12 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity + Stability - Incubation | Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent | Toluene | 20 % v/v | 68 | 60 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 4 mM Fructose 1,6-biphosphate | Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent | n-Hexane | 20 % v/v | 68 | 69 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 4 mM Fructose 1,6-biphosphate | Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 20 % v/v | 68 | 4 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 4 mM Fructose 1,6-biphosphate | Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent | Acetonitrile | 20 % v/v | 68 | 10 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 4 mM Fructose 1,6-biphosphate | Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent | Chloroform | 20 % v/v | 68 | 29 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 4 mM Fructose 1,6-biphosphate | Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent |
| Activity + Stability - Incubation | Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in the presence of organic solvent | Methanol | 20 % v/v | 68 | 66 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 4 mM Fructose 1,6-biphosphate | Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate | β | β | Water-incubated control (in %), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase | Toluene | 20 % v/v | 73 | 41 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 4 mM Fructose 1,6-biphosphate | Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate | β | β | Water-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase | n-Hexane | 20 % v/v | 73 | 55 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 4 mM Fructose 1,6-biphosphate | Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate | β | β | Water-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase | Dimethylformamide (DMF) | 20 % v/v | 73 | 26 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 4 mM Fructose 1,6-biphosphate | Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate | β | β | Water-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase | Acetonitrile | 20 % v/v | 73 | 16 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 4 mM Fructose 1,6-biphosphate | Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate | β | β | Water-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase | Chloroform | 20 % v/v | 73 | 54 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 4 mM Fructose 1,6-biphosphate | Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate | β | β | Water-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
| Stability - Incubation | Activity after incubation (1 day at room temperature) measured by absorbance spectrophotometry (glyceraldehyde-3-phosphate and hydrazone reaction product absorbance measurement, 240 nm) in aqueous phase | Methanol | 20 % v/v | 73 | 64 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, Assay: 50 mM Tris-HCl buffer, 0.1M phosphate acetate, 2 mM hydrazine dichloride hydrate | Incubation: 8, Assay: 8 | Incubation: Room temperature, Assay: 30Β°C | 4 mM Fructose 1,6-biphosphate | Dihydroxyacetone phosphate , Glyceraldehyde-3-phosphate | β | β | Water-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume. β β β Reference value. Hover for details.
Visualization : Activity + Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume. β β β Reference value. Hover for details.