Protease from Pseudomonas aeruginosa
Enzyme Description
Sequence
MKKVSTLDLLFVAIMGVSPAAFAADLIDVSKLPSKAAQGAPGPVTLQAAVGAGGADELKAIRSTTLPNGKQVTRYEQFHNGVRVVGEAITEVKGPGKSVAARRSGHFVANIAADLPGSTTAAVSAEQVLAQAKSLKAQGRKTENDKVELVIRLGENNIAQLVYNVSYLIPGEGLSRPHFVIDAKTGEVLDQWEGLAHAEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNGSTNDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFNLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVISSAQNRNYSAADVTRAFSTVGVTCPSAL
Anshu Gupta et al. (2005)
β Purification and characterization of a solvent stable protease from Pseudomonas aeruginosa PseA
Journal of Chromatography A
Β· doi:10.1016/j.chroma.2005.01.080 β
Β· Stability - Incubation
▼
Database ID
UniProt: Q3Y6H8 β
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, bacterium Pseudomonas aeruginosa
Experimental Data (7 measurements)
7 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (72 hours at 30Β°C), measured by absorbance spectrophotometry (free aromatic residues absorbance measurement, 280 nm) in aqueous phase | Benzene | 25 % v/v | 100 | 115 | % | Digital | Continuous | Incubation: 0.1M Tris-HCl buffer, Assay: 0.1M Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 60Β°C | 0.6% Casein | free amino acids , Peptides | β | 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (72 hours at 30Β°C), measured by absorbance spectrophotometry (free aromatic residues absorbance measurement, 280 nm) in aqueous phase | Toluene | 25 % v/v | 100 | 111 | % | Digital | Continuous | Incubation: 0.1M Tris-HCl buffer, Assay: 0.1M Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 60Β°C | 0.6% Casein | free amino acids , Peptides | β | 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (72 hours at 30Β°C), measured by absorbance spectrophotometry (free aromatic residues absorbance measurement, 280 nm) in aqueous phase | n-Hexane | 25 % v/v | 100 | 108 | % | Digital | Continuous | Incubation: 0.1M Tris-HCl buffer, Assay: 0.1M Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 60Β°C | 0.6% Casein | free amino acids , Peptides | β | 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (72 hours at 30Β°C), measured by absorbance spectrophotometry (free aromatic residues absorbance measurement, 280 nm) in aqueous phase | Cyclohexane | 25 % v/v | 100 | 104 | % | Digital | Continuous | Incubation: 0.1M Tris-HCl buffer, Assay: 0.1M Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 60Β°C | 0.6% Casein | free amino acids , Peptides | β | 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (72 hours at 30Β°C), measured by absorbance spectrophotometry (free aromatic residues absorbance measurement, 280 nm) in aqueous phase | n-Heptane | 25 % v/v | 100 | 79 | % | Digital | Continuous | Incubation: 0.1M Tris-HCl buffer, Assay: 0.1M Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 60Β°C | 0.6% Casein | free amino acids , Peptides | β | 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (72 hours at 30Β°C), measured by absorbance spectrophotometry (free aromatic residues absorbance measurement, 280 nm) in aqueous phase | 1-Butanol | 25 % v/v | 100 | 67 | % | Digital | Continuous | Incubation: 0.1M Tris-HCl buffer, Assay: 0.1M Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 60Β°C | 0.6% Casein | free amino acids , Peptides | β | 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
| Stability - Incubation | Activity after incubation (72 hours at 30Β°C), measured by absorbance spectrophotometry (free aromatic residues absorbance measurement, 280 nm) in aqueous phase | Isooctane | 25 % v/v | 100 | 64 | % | Digital | Continuous | Incubation: 0.1M Tris-HCl buffer, Assay: 0.1M Tris-HCl buffer | Incubation: 8, Assay: 8 | Incubation: 30Β°C, Assay: 60Β°C | 0.6% Casein | free amino acids , Peptides | β | 160 rpm | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase |
Visualization : Stability β Incubation
Anshu Gupta et al. (2005)
One bar per measurement. Colour = solvent, shade = solvent volume.
Anshu Gupta et al. (2006)
β A protease stable in organic solvents from solvent tolerant strain of Pseudomonas aeruginosa
Bioresource Technology
Β· doi:10.1016/j.biortech.2005.09.006 β
Β· Stability - Incubation
▼
Database ID
UniProt: Q3Y6H8 β
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, bacterium Pseudomonas aeruginosa
Experimental Data (21 measurements)
21 measurements β page 2 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (10 days at 30Β°C), measured by absorbance spectrophotometry (free aromatic residues absorbance measurement, 280 nm) in aqueous phase | Ethanol | 25 % v/v | 100 | 112 | % | Direct | Continuous | Incubation: protease production medium supernatant, Assay: 2g/L KH2PO4, 0.2g/L MgSO4.7H20, 4 g/L Casein, 6 g/L yeast extract, 0.5 g/L NaCl, 7 g/L glycerol, 0.6 MM CaCl2), 0.1M Tris-HCl | Incubation: 7, Assay: 8 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 140 rpm | Non-incubated control (in %), assay in aqueous phase | Clear about assay in aqueous phase |
Visualization : Stability β Incubation
Anshu Gupta et al. (2006)
One bar per measurement. Colour = solvent, shade = solvent volume.