Subtilisin Carlsberg from Bacillus licheniformis
Enzyme Description
Sequence
AQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYAKGVVVVALGSSFYYGKGLINVEAAAQ
Hiroyasu Ogino et al. (1999)
β Purification and characterization of organic solvent-stable protease from organic solvent-tolerant Pseudomonas aeruginosa PST-01
Journal of Bioscience and Bioengineering
Β· doi:10.1016/s1389-1723(99)80009-7 β
Β· Stability - Half-life
▼
Database ID
UniProt: P00780 β
Sequence Annotation
Inferred - from protein name (105 first residues from UniProt sequence absent from the mature protein)
Protein Source
Commercially purchased
Experimental Data (16 measurements)
16 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Ethylene Glycol | 25 % v/v | 0.3 | 14.3 | days | Direct | Continuous | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | 1,4-Butanediol | 25 % v/v | 0.3 | 25.0 | days | Direct | Continuous | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | 1,5-Pentanediol | 25 % v/v | 0.3 | >50.0 | days | Direct | Continuous | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Ethanol | 25 % v/v | 0.3 | >50.0 | days | Direct | Continuous | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | 1-Hexanol | 25 % v/v | 0.3 | 13.7 | days | Direct | Continuous | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Methanol | 25 % v/v | 0.3 | 26.2 | days | Direct | Continuous | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 25 % v/v | 0.3 | 6.4 | days | Direct | Continuous | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Isopropanol | 25 % v/v | 0.3 | 47.6 | days | Direct | Continuous | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Triethylene Glycol | 25 % v/v | 0.3 | 39.7 | days | Direct | Continuous | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | tert-Butanol | 25 % v/v | 0.3 | 41.6 | days | Direct | Continuous | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | 1-Heptanol | 25 % v/v | 0.3 | 8.6 | days | Direct | Continuous | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Dimethylformamide (DMF) | 25 % v/v | 0.3 | 39.8 | days | Direct | Continuous | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | 1-Butanol | 25 % v/v | 0.3 | 47.6 | days | Direct | Continuous | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Acetone | 25 % v/v | 0.3 | 24.8 | days | Direct | Continuous | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | 1,4-Dioxane | 25 % v/v | 0.3 | 29.3 | days | Direct | Continuous | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
| Stability - Half-life | Half-life (in days) with remaining activity measured by absorbance spectrophotometry (free tyrosines absorbance measurement, 280 nm) in aqueous phase | Toluene | 25 % v/v | 0.3 | 5.7 | days | Direct | Continuous | Incubation: 10 mM Borax-HCl buffer, Assay: 50 mM Borax-HCl buffer | Incubation: 8.5, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | Incubation: 160 rpm | Classical aqueous control (in days) |
Visualization : Stability β Half-life
Hiroyasu Ogino et al. (1999)
One bar per measurement. Colour = solvent, shade = solvent volume.
Guillermo R. Castro et al. (1999)
β Enzymatic activities of proteases dissolved in organic solvents
Enzyme and Microbial Technology
Β· doi:10.1016/S0141-0229(99)00099-X β
Β· Activity - Michaelis-Menten
▼
Database ID
UniProt: P00780 β
Sequence Annotation
Inferred - from protein name (105 first residues from UniProt sequence absent from the mature protein)
Protein Source
Commercially purchased
Experimental Data (3 measurements)
3 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Michaelis-Menten | Km (mM) measured by HPLC in the presence of organic solvent | Glycerol | 99 % v/v | 10.8 | 30.3 | mM | Direct | Continuous | 20 mM phosphate buffer | 7.8 | 30Β°C | Phenyl acetate | Acetic Acid , Phenol | β | β | Classical aqueous control (in mM) |
| Activity - Michaelis-Menten | Vmax (Β΅M/s mg) measured by HPLC in the presence of organic solvent | Glycerol | 99 % v/v | 5.75 | 7.56 | Β΅M/(s * mg) | Direct | Continuous | 20 mM phosphate buffer | 7.8 | 30Β°C | Phenyl acetate | Acetic Acid , Phenol | β | β | Classical aqueous control (in microM/(s * mg)) |
| Activity - Michaelis-Menten | Vm/Km (1/s mg) measured by HPLC in the presence of organic solvent | Glycerol | 99 % v/v | 0.53 | 0.25 | 1/(s * mg) | Direct | Continuous | 20 mM phosphate buffer | 7.8 | 30Β°C | Phenyl acetate | Acetic Acid , Phenol | β | β | Classical aqueous control (in 1/(s * mg)) |
Visualization : Activity β Michaelis-Menten
Guillermo R. Castro et al. (1999)
One bar per measurement. Colour = solvent, shade = solvent volume.
Hiroyasu Ogino et al. (2007)
β Stabilities and Conformational Transitions of Various Proteases in the Presence of an Organic Solvent
Biotechnology Progress
Β· doi:10.1021/bp060252p β
Β· Stability - Half-life
▼
Database ID
UniProt: P00780 β
Sequence Annotation
Inferred - from protein name (105 first residues from UniProt sequence absent from the mature protein)
Protein Source
Commercially purchased
Experimental Data (1 measurement)
1 measurement
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Half-life | Half-life (in hours) at 30Β°C measured using absorbance spectrophotometry (free aromatic residues absorbance measurement, 280 nm) | Methanol | 25 % v/v | 8.99 | 486.0 | hours | Direct | Continuous | Incubation: 10 mM sodium phosphate buffer, Assay: 50 mM borax-HCl | Incubation: ?, Assay: 8.5 | Incubation: 30Β°C, Assay: 30Β°C | 0.6% (w/v) Casein | free amino acids , Peptides | β | β | Classical aqueous control (in hours) |
Visualization : Stability β Half-life
Hiroyasu Ogino et al. (2007)
One bar per measurement. Colour = solvent, shade = solvent volume.
Ana Toplak et al. (2013)
β Proteolysin, a Novel Highly Thermostable and Cosolvent-Compatible Protease from the Thermophilic Bacterium Coprothermobacter proteolyticus
Applied and Environmental Microbiology
Β· doi:10.1128/AEM.01479-13 β
Β· Activity - Classical
▼
Database ID
UniProt: P00780 β
Sequence Annotation
Inferred - from protein name (105 first residues from UniProt sequence absent from the mature protein)
Protein Source
Commercially purchased
Experimental Data (18 measurements)
18 measurements
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurment, 410 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 40 % v/v | 100.0 | 2.5 | % | Digital | Continuous | 100 mM HEPES-NaOH buffer, 1 mM CaCl2, 10% organic solvent | 7.5 | 40Β°C | 1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-nitroaniline,N-succinyl-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) | Due to substrate low solubility in water, the reference was taken as the assay with 10% of the given organic solvent |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurment, 410 nm) in the presence of organic solvent | Ethanol | 60 % v/v | 100.0 | 2.0 | % | Digital | Continuous | 100 mM HEPES-NaOH buffer, 1 mM CaCl2, 10% organic solvent | 7.5 | 40Β°C | 1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-nitroaniline,N-succinyl-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) | Due to substrate low solubility in water, the reference was taken as the assay with 10% of the given organic solvent |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurment, 410 nm) in the presence of organic solvent | Ethanol | 50 % v/v | 100.0 | 2.0 | % | Digital | Continuous | 100 mM HEPES-NaOH buffer, 1 mM CaCl2, 10% organic solvent | 7.5 | 40Β°C | 1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-nitroaniline,N-succinyl-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) | Due to substrate low solubility in water, the reference was taken as the assay with 10% of the given organic solvent |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurment, 410 nm) in the presence of organic solvent | Ethanol | 40 % v/v | 100.0 | 4.9 | % | Digital | Continuous | 100 mM HEPES-NaOH buffer, 1 mM CaCl2, 10% organic solvent | 7.5 | 40Β°C | 1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-nitroaniline,N-succinyl-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) | Due to substrate low solubility in water, the reference was taken as the assay with 10% of the given organic solvent |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurment, 410 nm) in the presence of organic solvent | Ethanol | 30 % v/v | 100.0 | 8.9 | % | Digital | Continuous | 100 mM HEPES-NaOH buffer, 1 mM CaCl2, 10% organic solvent | 7.5 | 40Β°C | 1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-nitroaniline,N-succinyl-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) | Due to substrate low solubility in water, the reference was taken as the assay with 10% of the given organic solvent |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurment, 410 nm) in the presence of organic solvent | Ethanol | 20 % v/v | 100.0 | 22.3 | % | Digital | Continuous | 100 mM HEPES-NaOH buffer, 1 mM CaCl2, 10% organic solvent | 7.5 | 40Β°C | 1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-nitroaniline,N-succinyl-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) | Due to substrate low solubility in water, the reference was taken as the assay with 10% of the given organic solvent |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurment, 410 nm) in the presence of organic solvent | Ethanol | 10 % v/v | 100.0 | 100.0 | % | Digital | Continuous | 100 mM HEPES-NaOH buffer, 1 mM CaCl2, 10% organic solvent | 7.5 | 40Β°C | 1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-nitroaniline,N-succinyl-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) | Due to substrate low solubility in water, the reference was taken as the assay with 10% of the given organic solvent |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurment, 410 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 60 % v/v | 100.0 | 0.0 | % | Digital | Continuous | 100 mM HEPES-NaOH buffer, 1 mM CaCl2, 10% organic solvent | 7.5 | 40Β°C | 1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-nitroaniline,N-succinyl-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) | Due to substrate low solubility in water, the reference was taken as the assay with 10% of the given organic solvent |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurment, 410 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 50 % v/v | 100.0 | 0.5 | % | Digital | Continuous | 100 mM HEPES-NaOH buffer, 1 mM CaCl2, 10% organic solvent | 7.5 | 40Β°C | 1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-nitroaniline,N-succinyl-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) | Due to substrate low solubility in water, the reference was taken as the assay with 10% of the given organic solvent |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurment, 410 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100.0 | 100.0 | % | Digital | Continuous | 100 mM HEPES-NaOH buffer, 1 mM CaCl2, 10% organic solvent | 7.5 | 40Β°C | 1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-nitroaniline,N-succinyl-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) | Due to substrate low solubility in water, the reference was taken as the assay with 10% of the given organic solvent |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurment, 410 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 30 % v/v | 100.0 | 19.8 | % | Digital | Continuous | 100 mM HEPES-NaOH buffer, 1 mM CaCl2, 10% organic solvent | 7.5 | 40Β°C | 1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-nitroaniline,N-succinyl-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) | Due to substrate low solubility in water, the reference was taken as the assay with 10% of the given organic solvent |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurment, 410 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 20 % v/v | 100.0 | 58.5 | % | Digital | Continuous | 100 mM HEPES-NaOH buffer, 1 mM CaCl2, 10% organic solvent | 7.5 | 40Β°C | 1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-nitroaniline,N-succinyl-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) | Due to substrate low solubility in water, the reference was taken as the assay with 10% of the given organic solvent |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurment, 410 nm) in the presence of organic solvent | Dimethylformamide (DMF) | 10 % v/v | 100.0 | 100.0 | % | Digital | Continuous | 100 mM HEPES-NaOH buffer, 1 mM CaCl2, 10% organic solvent | 7.5 | 40Β°C | 1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-nitroaniline,N-succinyl-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) | Due to substrate low solubility in water, the reference was taken as the assay with 10% of the given organic solvent |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurment, 410 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 60 % v/v | 100.0 | 3.5 | % | Digital | Continuous | 100 mM HEPES-NaOH buffer, 1 mM CaCl2, 10% organic solvent | 7.5 | 40Β°C | 1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-nitroaniline,N-succinyl-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) | Due to substrate low solubility in water, the reference was taken as the assay with 10% of the given organic solvent |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurment, 410 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 50 % v/v | 100.0 | 7.4 | % | Digital | Continuous | 100 mM HEPES-NaOH buffer, 1 mM CaCl2, 10% organic solvent | 7.5 | 40Β°C | 1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-nitroaniline,N-succinyl-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) | Due to substrate low solubility in water, the reference was taken as the assay with 10% of the given organic solvent |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurment, 410 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 40 % v/v | 100.0 | 12.9 | % | Digital | Continuous | 100 mM HEPES-NaOH buffer, 1 mM CaCl2, 10% organic solvent | 7.5 | 40Β°C | 1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-nitroaniline,N-succinyl-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) | Due to substrate low solubility in water, the reference was taken as the assay with 10% of the given organic solvent |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurment, 410 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 30 % v/v | 100.0 | 22.3 | % | Digital | Continuous | 100 mM HEPES-NaOH buffer, 1 mM CaCl2, 10% organic solvent | 7.5 | 40Β°C | 1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-nitroaniline,N-succinyl-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) | Due to substrate low solubility in water, the reference was taken as the assay with 10% of the given organic solvent |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitroaniline absorbance measurment, 410 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20 % v/v | 100.0 | 44.6 | % | Digital | Continuous | 100 mM HEPES-NaOH buffer, 1 mM CaCl2, 10% organic solvent | 7.5 | 40Β°C | 1 mM N-succinyl-Ala-Ala-Pro-Phe-p-nitroanilide | p-nitroaniline,N-succinyl-Ala-Ala-Pro-Phe | β | β | Classical aqueous control (in %) | Due to substrate low solubility in water, the reference was taken as the assay with 10% of the given organic solvent |
Visualization : Activity β Classical
Ana Toplak et al. (2013)
One bar per measurement. Colour = solvent, shade = solvent volume.