Lipase (gene lip9) from Pseudomonas aeruginosa LST-03

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 311 amino acids
MKKKSLLPLGLAIGLASLAASPLIQASTYTQTKYPIVLAHGMLGFDNILGVDYWFGIPSALRRDGAQVYVTEVSQLDTSEVRGEQLLQQVEEIVALSGQPKVNLIGHSHGGPTIRYVAAVRPDLIASATSVGAPHKGSDTADFLRQIPPGSAGEAILSGLVNSLGALISFLSSGSTGTQNSLGSLESLNSEGAARFNAKYPQGIPTSACGEGAYKVNGVSYYSWSGSSPLTNFLDPSDAFLGASSLTFKNGTANDGLVGTCSSHLGMVIRDNYRMNHLDEVNQVFGLTSLFETSPVSVYRQHANRLKNASL
Hiroyasu Ogino et al. (2000) β€” Purification and characterization of organic solvent-stable lipase from organic solvent-tolerant Pseudomonas aeruginosa LST-03
Journal of Bioscience and Bioengineering  Β· doi:10.1016/s1389-1723(00)89095-7 β†—  Β· Activity - Classical Stability - Half-life
43 measurements
Database ID
UniProt: A8QYB2 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, bacterium Pseudomonas aeruginosa LST-03

Experimental Data (43 measurements)

43 measurements β€” page 3 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Half-life Half-life (in days) with remaining activity measured by absorbance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) Dimethyl Sulfoxide (DMSO) 25 % v/v 12.5 36.2 days Direct Continuous Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 2 mM Dimercaptopropan-1-ol tributyrate Butyric Acid , Free thiols β€” Incubation: 160 rpm Classical aqueous control (in days)
Stability - Half-life Half-life (in days) with remaining activity measured by absorbance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) Ethylene Glycol 25 % v/v 12.5 50.0 days Direct Continuous Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 2 mM Dimercaptopropan-1-ol tributyrate Butyric Acid , Free thiols β€” Incubation: 160 rpm Classical aqueous control (in days)
Stability - Half-life Half-life (in days) with remaining activity measured by absorbance spectrophotometry (colorimetric assay, free thiols and DTNB reaction product absorbance measurement, 412 nm) n-Decane 25 % v/v 12.5 >100.0 days Direct Continuous Incubation: 10 mM Tris-HCl, Assay: 100 mM Tris-HCl Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 30Β°C 2 mM Dimercaptopropan-1-ol tributyrate Butyric Acid , Free thiols β€” Incubation: 160 rpm Classical aqueous control (in days)
1 2 3
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Half-life

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*