Luciferase from Oplophorus gracilirostris (luminous shrimp)

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 169 amino acids
FTLADFVGDWQQTAGYNQDQVLEQGGLSSLFQALGVSVTPIQKVVLSGENGLKADIHVIIPYEGLSGFQMGLIEMIFKVVYPVDDHHFKIILHYGTLVIDGVTPNMIDYFGRPYPGIAVFDGKQITVTGTLWNGNKIYDERLINPDGSLLFRVTINGVTGWRLCENILA
Satoshi Inouye et al. (2007) β€” Overexpression, purification and characterization of the catalytic component of Oplophorus luciferase in the deep-sea shrimp, Oplophorus gracilirostris
Protein Expression and Purification  Β· doi:10.1016/j.pep.2007.08.002 β†—  Β· Activity - Classical
63 measurements
Database ID
UniProt: Q9GV45 β†—
Sequence Annotation
Inferred - from protein name (27 first residues from UniProt sequence absent from the mature protein)
Protein Source
Recombinant, host bacterium Escherichia coli BL21

Experimental Data (63 measurements)

63 measurements β€” page 4 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (luminescence measurement, 454 nm) Dimethyl Sulfoxide (DMSO) 15 % v/v 100 32 % Digital Continuous 30 mM Tris-HCl buffer, 10 mM EDTA 7.6 25Β°C 1 Β΅g/Β΅L Coelenterazine, ? mM Oβ‚‚ Carbon Dioxide (CO2) , coelenteramide , photon β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (luminescence measurement, 454 nm) Dimethyl Sulfoxide (DMSO) 20 % v/v 100 9 % Digital Continuous 30 mM Tris-HCl buffer, 10 mM EDTA 7.6 25Β°C 1 Β΅g/Β΅L Coelenterazine, ? mM Oβ‚‚ Carbon Dioxide (CO2) , coelenteramide , photon β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (luminescence measurement, 454 nm) Methanol 1 % v/v 100 124 % Digital Continuous 30 mM Tris-HCl buffer, 10 mM EDTA 7.6 25Β°C 1 Β΅g/Β΅L Bis-coelenterazine Bis-coelenteramide , Carbon Dioxide (CO2) , photon β€” β€” Classical aqueous control (in %)
1 2 3 4
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*