Short-chain NAD(H)-dependent dehydrogenase/reductase from Sulfolobus acidocaldarius
Enzyme Description
Extremophile
Yes
"thermoacidophilic" organism
EC Number
Sequence
MDIDRLFSVKGMNAVVLGASSGIGKAIAEMFSEMGGKVVLSDIDEEGLKRLSDSLRSRGHEVNHMKCDITDLNQVKKLVNFSLSVYGNVDALYVTPSINVRKSIENYTYEDFEKVINVNLKGNFMVVKEFLSVMKNNKGGGSVVLFSSIRGTVVEPGQSVYAMTKAGIIQLAKVAAAEYGKYNIRVNVIAPGVVDTPLTRQIKSDPEWFKAYTEKTILKRWATPEEIANVALFLAMPASSYITGTVIYVDGGWTAIDGRYDPKV
Angela Pennacchio et al. (2010)
β Biochemical characterization of a recombinant short-chain NAD(H)-dependent dehydrogenase/reductase from Sulfolobus acidocaldarius
Extremophiles
Β· doi:10.1007/s00792-009-0298-3 β
Β· Stability - Incubation
▼
Database ID
NCBI: WP_011278925.1 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (34 measurements)
34 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Methanol | 17 % v/v | 115 | 116 | % | Digital | Continuous | 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer | Incubation: 6, Assay: 6 | Incubation: 50Β°C, Assay: 65Β°C | 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol | Ξ±-Tetralone | 5 mM NAD+ | β | Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation |
| Stability - Incubation | Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | n-Heptane | 17 % v/v | 115 | 109 | % | Digital | Continuous | 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer | Incubation: 6, Assay: 6 | Incubation: 50Β°C, Assay: 65Β°C | 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol | Ξ±-Tetralone | 5 mM NAD+ | β | Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation |
| Stability - Incubation | Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | n-Heptane | 17 % v/v | 103 | 151 | % | Digital | Continuous | 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer | Incubation: 6, Assay: 6 | Incubation: 50Β°C, Assay: 65Β°C | 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol | Ξ±-Tetralone | 5 mM NAD+ | β | Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation |
| Stability - Incubation | Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | n-Heptane | 30 % v/v | 115 | 147 | % | Digital | Continuous | 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer | Incubation: 6, Assay: 6 | Incubation: 50Β°C, Assay: 65Β°C | 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol | Ξ±-Tetralone | 5 mM NAD+ | β | Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation |
| Stability - Incubation | Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | n-Heptane | 30 % v/v | 103 | 181 | % | Digital | Continuous | 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer | Incubation: 6, Assay: 6 | Incubation: 50Β°C, Assay: 65Β°C | 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol | Ξ±-Tetralone | 5 mM NAD+ | β | Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation |
| Stability - Incubation | Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | tert-Butyl Methyl Ether (MTBE) | 17 % v/v | 115 | 138 | % | Digital | Continuous | 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer | Incubation: 6, Assay: 6 | Incubation: 50Β°C, Assay: 65Β°C | 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol | Ξ±-Tetralone | 5 mM NAD+ | β | Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation |
| Stability - Incubation | Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | tert-Butyl Methyl Ether (MTBE) | 17 % v/v | 103 | 159 | % | Digital | Continuous | 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer | Incubation: 6, Assay: 6 | Incubation: 50Β°C, Assay: 65Β°C | 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol | Ξ±-Tetralone | 5 mM NAD+ | β | Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation |
| Stability - Incubation | Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | tert-Butyl Methyl Ether (MTBE) | 30 % v/v | 115 | 148 | % | Digital | Continuous | 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer | Incubation: 6, Assay: 6 | Incubation: 50Β°C, Assay: 65Β°C | 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol | Ξ±-Tetralone | 5 mM NAD+ | β | Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation |
| Stability - Incubation | Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | tert-Butyl Methyl Ether (MTBE) | 30 % v/v | 103 | 214 | % | Digital | Continuous | 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer | Incubation: 6, Assay: 6 | Incubation: 50Β°C, Assay: 65Β°C | 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol | Ξ±-Tetralone | 5 mM NAD+ | β | Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation |
| Stability - Incubation | Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | n-Hexane | 30 % v/v | 103 | 166 | % | Digital | Continuous | 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer | Incubation: 6, Assay: 6 | Incubation: 50Β°C, Assay: 65Β°C | 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol | Ξ±-Tetralone | 5 mM NAD+ | β | Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation |
| Stability - Incubation | Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Methanol | 17 % v/v | 103 | 146 | % | Digital | Continuous | 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer | Incubation: 6, Assay: 6 | Incubation: 50Β°C, Assay: 65Β°C | 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol | Ξ±-Tetralone | 5 mM NAD+ | β | Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation |
| Stability - Incubation | Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Methanol | 30 % v/v | 115 | 87 | % | Digital | Continuous | 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer | Incubation: 6, Assay: 6 | Incubation: 50Β°C, Assay: 65Β°C | 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol | Ξ±-Tetralone | 5 mM NAD+ | β | Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation |
| Stability - Incubation | Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Methanol | 30 % v/v | 103 | 114 | % | Digital | Continuous | 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer | Incubation: 6, Assay: 6 | Incubation: 50Β°C, Assay: 65Β°C | 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol | Ξ±-Tetralone | 5 mM NAD+ | β | Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation |
| Stability - Incubation | Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | 1,4-Dioxane | 17 % v/v | 115 | 135 | % | Digital | Continuous | 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer | Incubation: 6, Assay: 6 | Incubation: 50Β°C, Assay: 65Β°C | 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol | Ξ±-Tetralone | 5 mM NAD+ | β | Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation |
| Stability - Incubation | Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | 1,4-Dioxane | 17 % v/v | 103 | 167 | % | Digital | Continuous | 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer | Incubation: 6, Assay: 6 | Incubation: 50Β°C, Assay: 65Β°C | 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol | Ξ±-Tetralone | 5 mM NAD+ | β | Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation |
| Stability - Incubation | Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | 1,4-Dioxane | 30 % v/v | 115 | 36 | % | Digital | Continuous | 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer | Incubation: 6, Assay: 6 | Incubation: 50Β°C, Assay: 65Β°C | 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol | Ξ±-Tetralone | 5 mM NAD+ | β | Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation |
| Stability - Incubation | Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | 1,4-Dioxane | 30 % v/v | 103 | 39 | % | Digital | Continuous | 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer | Incubation: 6, Assay: 6 | Incubation: 50Β°C, Assay: 65Β°C | 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol | Ξ±-Tetralone | 5 mM NAD+ | β | Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation |
| Stability - Incubation | Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Ethyl Acetate | 30 % v/v | 103 | 187 | % | Digital | Continuous | 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer | Incubation: 6, Assay: 6 | Incubation: 50Β°C, Assay: 65Β°C | 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol | Ξ±-Tetralone | 5 mM NAD+ | β | Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation |
| Stability - Incubation | Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Isopropanol | 7 % v/v | 103 | 120 | % | Digital | Continuous | 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer | Incubation: 6, Assay: 6 | Incubation: 50Β°C, Assay: 65Β°C | 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol | Ξ±-Tetralone | 5 mM NAD+ | β | Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation |
| Stability - Incubation | Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent | Isopropanol | 17 % v/v | 115 | 126 | % | Digital | Continuous | 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer | Incubation: 6, Assay: 6 | Incubation: 50Β°C, Assay: 65Β°C | 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol | Ξ±-Tetralone | 5 mM NAD+ | β | Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.