Short-chain NAD(H)-dependent dehydrogenase/reductase from Sulfolobus acidocaldarius

Enzyme Description

Extremophile
Yes "thermoacidophilic" organism
EC Number

Sequence

Length: 264 amino acids
MDIDRLFSVKGMNAVVLGASSGIGKAIAEMFSEMGGKVVLSDIDEEGLKRLSDSLRSRGHEVNHMKCDITDLNQVKKLVNFSLSVYGNVDALYVTPSINVRKSIENYTYEDFEKVINVNLKGNFMVVKEFLSVMKNNKGGGSVVLFSSIRGTVVEPGQSVYAMTKAGIIQLAKVAAAEYGKYNIRVNVIAPGVVDTPLTRQIKSDPEWFKAYTEKTILKRWATPEEIANVALFLAMPASSYITGTVIYVDGGWTAIDGRYDPKV
Angela Pennacchio et al. (2010) β€” Biochemical characterization of a recombinant short-chain NAD(H)-dependent dehydrogenase/reductase from Sulfolobus acidocaldarius
Extremophiles  Β· doi:10.1007/s00792-009-0298-3 β†—  Β· Stability - Incubation
34 measurements
Database ID
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (34 measurements)

34 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 17 % v/v 103 85 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 30 % v/v 115 32 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 30 % v/v 103 6 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Ethyl Acetate 17 % v/v 115 140 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Ethyl Acetate 17 % v/v 103 170 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Ethyl Acetate 30 % v/v 115 163 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 7 % v/v 115 107 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 17 % v/v 115 114 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 17 % v/v 103 123 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 30 % v/v 115 4 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 30 % v/v 103 0 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent n-Hexane 17 % v/v 115 61 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent n-Hexane 17 % v/v 103 71 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent n-Hexane 30 % v/v 115 132 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
1 2
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*