Short-chain NAD(H)-dependent dehydrogenase/reductase from Sulfolobus acidocaldarius

Enzyme Description

Species
Sulfolobus acidocaldarius DSM 639 β†—
Extremophile
Yes "thermoacidophilic" organism
EC Number
1.1.1.1 β†—

Sequence

Length: 264 amino acids
MDIDRLFSVKGMNAVVLGASSGIGKAIAEMFSEMGGKVVLSDIDEEGLKRLSDSLRSRGHEVNHMKCDITDLNQVKKLVNFSLSVYGNVDALYVTPSINVRKSIENYTYEDFEKVINVNLKGNFMVVKEFLSVMKNNKGGGSVVLFSSIRGTVVEPGQSVYAMTKAGIIQLAKVAAAEYGKYNIRVNVIAPGVVDTPLTRQIKSDPEWFKAYTEKTILKRWATPEEIANVALFLAMPASSYITGTVIYVDGGWTAIDGRYDPKV
Angela Pennacchio et al. (2010) β€” Biochemical characterization of a recombinant short-chain NAD(H)-dependent dehydrogenase/reductase from Sulfolobus acidocaldarius
Extremophiles  Β· doi:10.1007/s00792-009-0298-3 β†—  Β· Stability - Incubation
34 measurements ▼
Database ID
NCBI: WP_011278925.1 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (34 measurements)

34 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 17 % v/v 115 116 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent n-Heptane 17 % v/v 115 109 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent n-Heptane 17 % v/v 103 151 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent n-Heptane 30 % v/v 115 147 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent n-Heptane 30 % v/v 103 181 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent tert-Butyl Methyl Ether (MTBE) 17 % v/v 115 138 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent tert-Butyl Methyl Ether (MTBE) 17 % v/v 103 159 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent tert-Butyl Methyl Ether (MTBE) 30 % v/v 115 148 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent tert-Butyl Methyl Ether (MTBE) 30 % v/v 103 214 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent n-Hexane 30 % v/v 103 166 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 17 % v/v 103 146 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 30 % v/v 115 87 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 30 % v/v 103 114 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent 1,4-Dioxane 17 % v/v 115 135 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent 1,4-Dioxane 17 % v/v 103 167 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent 1,4-Dioxane 30 % v/v 115 36 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent 1,4-Dioxane 30 % v/v 103 39 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Ethyl Acetate 30 % v/v 103 187 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (24 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 7 % v/v 103 120 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
Stability - Incubation Activity after incubation (6 hours at 50Β°C), measured by absorance spectrophotometry (change in NADH absorbance measurement, 340 nm) in the presence of organic solvent Isopropanol 17 % v/v 115 126 % Digital Continuous 100 mM MES buffer, 5 mM 2-mercaptoethanol incubation, 100 mM MES buffer, 5 mM 2-mercaptoethanol buffer Incubation: 6, Assay: 6 Incubation: 50Β°C, Assay: 65Β°C 10 mM (R)-(-)-1,2,3,4-Tetrahydro-1-naphthol Ξ±-Tetralone 5 mM NAD+ β€” Water-incubated control (in %) | Actvity measured in water before and after incubation, activity measured in the presence of organic solvent before and after incubation
β€Ή Prev
1 2
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*