Feruloyl esterase C (gene faeC) from Talaromyces stipitatus

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 530 amino acids
MMLTSAILLLTLGVQLSHADDSSRENFSNRCDQLAKEIHIPNVTVNFVEYVANGTNVTLADNPPSCGQSNQVVLADLCRVAMEVTTSNQSQITLEAWFPENYTGRFLSTGNGGLAGCIQYVDMAYASSMGFATVGANGGHNGTSGESFYHNPDIVEDLSWRSVHTGVVVGKELTKKFYHEGFHKSYYLGCSTGGRQGFKAVQEFVHDFDGVVAGCPAFNFVNLNSWSGHFYPITGNSSADTFLTTAQWTLVQQSVMEQCDSLDGAVDGVIEAIDQCHPVFEQLICRPGQNASECLTGKQVNTAQLVLSPIYGTKGEFLYPRMQPGVENVDMYITYNGDPFAYSTDWYKYVVFSDPNWDPATLNAQDYEIALAQNPSNIQTFEGDLSAFRDAGAKVLTYHGTADPIITGETSKVYYRHVAETMNAAPEELDEFYRYFRIGGMSHCGGGTGATAIGNVLSAQWSNDPDANVLMAMVRWVEEGVAPEYIRGASLGSGPGAKVEYTRRHCKYPTRNVYVGPGNWTDENAWKCIL
Craig B. Faulds et al. (2011) β€” Influence of organic co-solvents on the activity and substrate specificity of feruloyl esterases
Bioresource Technology  Β· doi:10.1016/j.biortech.2011.01.088 β†—  Β· Activity - Classical Activity - Michaelis-Menten Stability - C50 Stability - Incubation Activity + Stability - Incubation
133 measurements
Database ID
UniProt: B8LV47 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host yeast Pichia pastoris

Experimental Data (133 measurements)

133 measurements β€” page 7 of 7
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Incubation Activity after incubation (96 hours at 37Β°C) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 25 % v/v 1168.0 795.0 U/mg Direct Continuous Incubation: 100 mM MOPS, Assay: 100 mM MOPS Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Non-incubated control (in U/mg), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent and control in aqueous phase
Activity + Stability - Incubation Activity after incubation (96 hours at 37Β°C) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent Acetone 25 % v/v 1168.0 1036.0 U/mg Direct Continuous Incubation: 100 mM MOPS, Assay: 100 mM MOPS Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Non-incubated control (in U/mg), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent and control in aqueous phase
Activity + Stability - Incubation Activity after incubation (96 hours at 37Β°C) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 25 % v/v 1223.0 1112.0 U/mg Direct Continuous Incubation: 100 mM MOPS, Assay: 100 mM MOPS Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Non-incubated control (in U/mg), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent and control in aqueous phase
Activity + Stability - Incubation Activity after incubation (96 hours at 37Β°C) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Acetone 25 % v/v 1223.0 1074.0 U/mg Direct Continuous Incubation: 100 mM MOPS, Assay: 100 mM MOPS Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Non-incubated control (in U/mg), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent and control in aqueous phase
Stability - C50 Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) β€” β€” 33.0 % (v/v) Direct Continuous 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Not applicable control (in % (v/v))
Stability - C50 Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) β€” β€” 23.0 % (v/v) Direct Continuous 100 mM MOPS 6 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Not applicable control (in % (v/v))
Stability - C50 Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent Acetone β€” β€” 19.0 % (v/v) Direct Continuous 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Not applicable control (in % (v/v))
Stability - C50 Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Acetone β€” β€” 8.0 % (v/v) Direct Continuous 100 mM MOPS 6 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Not applicable control (in % (v/v))
Stability - C50 Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent 1,4-Dioxane β€” β€” 13.0 % (v/v) Direct Continuous 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Not applicable control (in % (v/v))
Stability - Incubation Activity after incubation (96 hours at 37Β°C) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 25 % v/v 1187.0 795.0 U/mg Direct Continuous Incubation: 100 mM MOPS, Assay: 100 mM MOPS Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Non-incubated control (in U/mg) in the presence of organic solvent (1 minute incubation, 5% DMSO), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent and control in the presence of organic solvent
Stability - Incubation Activity after incubation (96 hours at 37Β°C) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent Acetone 25 % v/v 1276.0 1036.0 U/mg Direct Continuous Incubation: 100 mM MOPS, Assay: 100 mM MOPS Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Non-incubated control (in U/mg) in the presence of organic solvent (1 minute incubation, 5% acetone), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent and control in the presence of organic solvent
Stability - Incubation Activity after incubation (96 hours at 37Β°C) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 25 % v/v 1178.0 1112.0 U/mg Direct Continuous Incubation: 100 mM MOPS, Assay: 100 mM MOPS Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Non-incubated control (in U/mg) in the presence of organic solvent (1 minute incubation, 5% DMSO), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent and control in the presence of organic solvent
Stability - Incubation Activity after incubation (96 hours at 37Β°C) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Acetone 25 % v/v 952.0 1074.0 U/mg Direct Continuous Incubation: 100 mM MOPS, Assay: 100 mM MOPS Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Non-incubated control (in U/mg) in the presence of organic solvent (1 minute incubation, 5% acetone), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent and control in the presence of organic solvent
1 … 4 5 6 7
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity β€” Michaelis-Menten

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” C50

One bar per measurement. Colour = solvent, shade = temperature. Hover for details.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*