Ene-reductase KYE1 from Kluyveromyces lactis

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 398 amino acids
MSFMNFEPKPLADTDIFKPIKIGNTELKHRVVMPALTRMRALHPGNVPNPDWAVEYYRQRSQYPGTMIITEGAFPSAQSGGYDNAPGVWSEEQLAQWRKIFKAIHDNKSFVWVQLWVLGRQAFADNLARDGLRYDSASDEVYMGEDEKERAIRSNNPQHGITKDEIKQYIRDYVDAAKKCIDAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIENRARFVLEVVDAVVDAVGAERTSIRFSPYGVFGTMSGGSDPVLVAQFAYVLAELEKRAKAGKRLAYVDLVEPRVTSPFQPEFEGWYKGGTNEFVYSVWKGNVLRVGNYALDPDAAITDSKNPNTLIGYGRAFIANPDLVERLEKGLPLNQYDRPSFYKMSAEGYIDYPTYEEAVAKGYKK
Yanto Yanto et al. (2011) β€” Asymmetric bioreduction of alkenes using ene-reductases YersER and KYE1 and effects of organic solvents
Organic Letters  Β· doi:10.1021/ol200394p β†—  Β· Stability - C50 Activity + Stability - Conversion Selectivity - Enantioselectivity
84 measurements
Database ID
UniProt: P40952 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21

Experimental Data (84 measurements)

84 measurements β€” page 2 of 5
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography Dimethyl Sulfoxide (DMSO) 40 % v/v 67.0 16.0 % Digital Continuous 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography Dimethyl Sulfoxide (DMSO) 50 % v/v 67.0 15.0 % Digital Continuous 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography n-Hexane 10 % v/v 67.0 63.0 % Digital Continuous 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography n-Hexane 20 % v/v 67.0 65.0 % Digital Continuous 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography n-Hexane 30 % v/v 67.0 60.0 % Digital Continuous 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography n-Hexane 40 % v/v 67.0 66.0 % Digital Continuous 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography n-Hexane 50 % v/v 67.0 62.0 % Digital Continuous 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography Toluene 10 % v/v 67.0 67.0 % Digital Continuous 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography Toluene 20 % v/v 67.0 68.0 % Digital Continuous 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography Toluene 30 % v/v 67.0 69.0 % Digital Continuous 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography Toluene 40 % v/v 67.0 63.0 % Digital Continuous 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography Toluene 50 % v/v 67.0 64.0 % Digital Continuous 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM Citral Citronellal 0.2 mM NADP+ β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography n-Hexane 20 % v/v 100.0 100.0 % Digital Continuous 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM 2-Cyclohexen-1-one Cyclohexanone 0.2 mM NADP+ β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography Ethylene Glycol 80 % v/v 100.0 0.0 % Digital Continuous 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM 2-Cyclohexen-1-one Cyclohexanone 0.2 mM NADP+ β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography Ethylene Glycol 70 % v/v 100.0 0.0 % Digital Continuous 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM 2-Cyclohexen-1-one Cyclohexanone 0.2 mM NADP+ β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography Dimethyl Sulfoxide (DMSO) 10 % v/v 100.0 89.0 % Digital Continuous 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM 2-Cyclohexen-1-one Cyclohexanone 0.2 mM NADP+ β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography Dimethyl Sulfoxide (DMSO) 20 % v/v 100.0 90.0 % Digital Continuous 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM 2-Cyclohexen-1-one Cyclohexanone 0.2 mM NADP+ β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography Ethylene Glycol 60 % v/v 100.0 7.0 % Digital Continuous 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM 2-Cyclohexen-1-one Cyclohexanone 0.2 mM NADP+ β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography Dimethyl Sulfoxide (DMSO) 25 % v/v 100.0 61.0 % Digital Continuous 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM 2-Cyclohexen-1-one Cyclohexanone 0.2 mM NADP+ β€” Classical aqueous control (in %)
Activity + Stability - Conversion Conversion after incubation (12 hours at 30Β°C) in the presence of organic solvent, measured by gas chromatography Dimethyl Sulfoxide (DMSO) 30 % v/v 100.0 22.0 % Digital Continuous 200 mM phosphate buffern 20 mM glucose, 10 U/ml GDH (cofactor recycling) 7.5 30Β°C 10 mM 2-Cyclohexen-1-one Cyclohexanone 0.2 mM NADP+ β€” Classical aqueous control (in %)
1 2 3 4 5

Visualization : Stability β€” C50

One bar per measurement. Colour = solvent, shade = temperature. Hover for details.

Visualization : Activity + Stability β€” Conversion

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Selectivity - Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*