Haloalkane dehalogenase linB from Sphingobium japonicum

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 296 amino acids
MSLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Veronika Stepankova et al. (2013) β€” Organic co-solvents affect activity, stability and enantioselectivity of haloalkane dehalogenases
Biotechnology Journal  Β· doi:10.1002/biot.201200378 β†—  Β· Activity - Classical Stability - C50 Stability - Tm
136 measurements
Database ID
UniProt: D4Z2G1 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli BL21

Experimental Data (136 measurements)

136 measurements β€” page 1 of 7
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Glycerol 5 % v/v 100 91 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Formamide 5 % v/v 100 88 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Ethylene Glycol 5 % v/v 100 92 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent PEG-1000 5 % v/v 100 101 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent PEG-10000 5 % v/v 100 85 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Dimethylformamide (DMF) 5 % v/v 100 81 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5 % v/v 100 86 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Methanol 5 % v/v 100 93 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent 1,4-Dioxane 5 % v/v 100 41 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Acetonitrile 5 % v/v 100 71 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Ethanol 5 % v/v 100 93 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Acetone 5 % v/v 100 110 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Isopropanol 5 % v/v 100 85 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Tetrahydrofuran (THF) 5 % v/v 100 64 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Glycerol 10 % v/v 100 90 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Formamide 10 % v/v 100 80 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Ethylene Glycol 10 % v/v 100 101 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent PEG-1000 10 % v/v 100 104 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent PEG-10000 10 % v/v 100 80 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (colorimetric assay, iodine, mercuric thiocyanate and ferric ammonium sulfate reaction product Fe–SCN absorbance measurement, 460 nm) in the presence of organic solvent Dimethylformamide (DMF) 10 % v/v 100 78 % Direct Continuous glycine 100 mM 8.6 37Β°C ? mM 1-Iodohexane 1-Hexanol , Iodide ion β€” β€” Classical aqueous control (in %)
β€Ή Prev
1 2 3 4 … 7

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Tm

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” C50

One bar per measurement. Colour = solvent, shade = temperature. Hover for details.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*