Esterase (gene EstA) with mesophilic expression from Sulfolobus islandicus

Enzyme Description

Extremophile
Yes thermophilic organism
EC Number

Sequence

Length: 305 amino acids
MPLDPRIKELLESGFIVPIGKASVDEVRKIFRQLASAAPKVEVGKVEDIKIPGSEANINARVYLPKANGPYGVLIYLHGGGFVIGDVESYDPLCRAITNACNCVVVSVDYRLAPEYKFPSAVIDSFDATNWVYNNLDKFDGKMGVAIAGDSAGGNLAAVVALLSKGKLNLKYQILIYPAVGFDSVSRSMIEYSDGFFLTREHIEWFGSQYLRSPADLLDFRFSPILAQDLSGLPPALIITAEYDPLRDQGEAYANRLLQAGVPVTSVRFNNVIHGFLSFFPLIEQGRDAISLIGSVLRRTFYDKS
Yuxia Mei et al. (2011) β€” Exceptional thermal stability and organic solvent tolerance of an esterase expressed from a thermophilic host
Applied Microbiology and Biotechnology  Β· doi:10.1007/s00253-011-3504-z β†—  Β· Stability - Incubation
22 measurements
Database ID
UniProt: F0NDQ1 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (22 measurements)

22 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase Dimethyl Sulfoxide (DMSO) 60 % v/v 100.0 12.3 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase Chloroform 60 % v/v 100.0 0.0 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase Chloroform 30 % v/v 100.0 0.0 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase n-Hexane 60 % v/v 100.0 0.0 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase n-Hexane 30 % v/v 100.0 10.2 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase Isoamyl Alcohol 60 % v/v 100.0 0.0 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase Isoamyl Alcohol 30 % v/v 100.0 7.9 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase 1-Butanol 60 % v/v 100.0 6.4 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase 1-Butanol 30 % v/v 100.0 17.9 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase Acetonitrile 60 % v/v 100.0 4.3 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase Acetonitrile 30 % v/v 100.0 39.7 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase Methanol 30 % v/v 100.0 61.3 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase Dimethyl Sulfoxide (DMSO) 30 % v/v 100.0 73.0 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase Isopropanol 60 % v/v 100.0 19.1 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase Isopropanol 30 % v/v 100.0 30.2 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase 1-Propanol 60 % v/v 100.0 9.2 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase 1-Propanol 30 % v/v 100.0 31.6 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase Acetone 60 % v/v 100.0 13.7 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase Acetone 30 % v/v 100.0 63.0 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
Stability - Incubation Activity after incubation (30 minutes at 70Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement) in aqueous phase Ethanol 60 % v/v 100.0 17.5 % Direct Continuous Incubation: 50 mM phosphate buffer, 150 mM NaCl, Assay: 50 mM Tris-HCl, 0.4% Triton X-100, 0.1% gum arabic (according to reference) Incubation: 7, Assay: 8 Incubation: 70Β°C, Assay: 65Β°C 8 mM p-Nitrophenyl hexanoate Hexanoic Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), residual activity measured in aqueous phase | Uncertainty about whether assay was really in aqueous phase
β€Ή Prev
1 2

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*