Pancreas elastase from Sus scrofa (pig)

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 240 amino acids
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Bassem Jaouadi et al. (2013) β€” Biochemical and molecular characterization of Pseudomonas aeruginosa CTM50182 organic solvent-stable elastase
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2013.05.019 β†—  Β· Stability - Incubation
40 measurements
Database ID
UniProt: P00772 β†—
Sequence Annotation
Inferred - from protein name (26 first residues from UniProt sequence absent from the mature protein)
Protein Source
Commercially purchased

Experimental Data (40 measurements)

40 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase 1-Hexanol 60 % v/v 100 75 % Direct Continuous Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase n-Decane 60 % v/v 100 85 % Direct Continuous Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Isooctane 60 % v/v 100 102 % Direct Continuous Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase n-Octane 60 % v/v 100 110 % Direct Continuous Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase n-Heptane 60 % v/v 100 115 % Direct Continuous Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase n-Hexane 60 % v/v 100 101 % Direct Continuous Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Cyclohexane 60 % v/v 100 99 % Direct Continuous Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Toluene 60 % v/v 100 93 % Direct Continuous Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Benzene 60 % v/v 100 91 % Direct Continuous Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Chloroform 60 % v/v 100 112 % Direct Continuous Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase n-Hexadecane 60 % v/v 100 81 % Direct Continuous Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase 1-Butanol 60 % v/v 100 50 % Direct Continuous Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Ethyl Acetate 60 % v/v 100 0 % Direct Continuous Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Isopropanol 60 % v/v 100 111 % Direct Continuous Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Isopropanol 60 % v/v 100 110 % Direct Continuous Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Acetonitrile 60 % v/v 100 0 % Direct Continuous Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Ethanol 60 % v/v 100 62 % Direct Continuous Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Methanol 60 % v/v 100 71 % Direct Continuous Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Dimethylformamide (DMF) 60 % v/v 100 121 % Direct Continuous Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (90 days at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin–Ciocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 60 % v/v 100 150 % Direct Continuous Incubation: ?, Assay: 50 mM Na2HPO4–NaOH buffer, 5mM CoCl2 Incubation: ?, Assay: 10 Incubation: 30Β°C, Assay: 60Β°C ? mM Casein free amino acids , Peptides β€” Incubation: 150 rpm Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
β€Ή Prev
1 2

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*