Pancreas elastase from Sus scrofa (pig)
Enzyme Description
Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Bassem Jaouadi et al. (2013)
β Biochemical and molecular characterization of Pseudomonas aeruginosa CTM50182 organic solvent-stable elastase
International Journal of Biological Macromolecules
Β· doi:10.1016/j.ijbiomac.2013.05.019 β
Β· Stability - Incubation
▼
Database ID
UniProt: P00772 β
Sequence Annotation
Inferred - from protein name (26 first residues from UniProt sequence absent from the mature protein)
Protein Source
Commercially purchased
Experimental Data (40 measurements)
40 measurements β page 2 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, FolinβCiocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase | 1-Hexanol | 60 % v/v | 100 | 85 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Na2HPO4βNaOH buffer, 5mM CoCl2 | Incubation: ?, Assay: 10 | Incubation: 30Β°C, Assay: 60Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 150 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, FolinβCiocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase | n-Decane | 60 % v/v | 100 | 91 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Na2HPO4βNaOH buffer, 5mM CoCl2 | Incubation: ?, Assay: 10 | Incubation: 30Β°C, Assay: 60Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 150 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, FolinβCiocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase | Isooctane | 60 % v/v | 100 | 111 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Na2HPO4βNaOH buffer, 5mM CoCl2 | Incubation: ?, Assay: 10 | Incubation: 30Β°C, Assay: 60Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 150 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, FolinβCiocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase | n-Octane | 60 % v/v | 100 | 120 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Na2HPO4βNaOH buffer, 5mM CoCl2 | Incubation: ?, Assay: 10 | Incubation: 30Β°C, Assay: 60Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 150 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, FolinβCiocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase | n-Heptane | 60 % v/v | 100 | 130 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Na2HPO4βNaOH buffer, 5mM CoCl2 | Incubation: ?, Assay: 10 | Incubation: 30Β°C, Assay: 60Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 150 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, FolinβCiocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase | n-Hexane | 60 % v/v | 100 | 110 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Na2HPO4βNaOH buffer, 5mM CoCl2 | Incubation: ?, Assay: 10 | Incubation: 30Β°C, Assay: 60Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 150 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, FolinβCiocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase | Cyclohexane | 60 % v/v | 100 | 108 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Na2HPO4βNaOH buffer, 5mM CoCl2 | Incubation: ?, Assay: 10 | Incubation: 30Β°C, Assay: 60Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 150 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, FolinβCiocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase | Toluene | 60 % v/v | 100 | 101 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Na2HPO4βNaOH buffer, 5mM CoCl2 | Incubation: ?, Assay: 10 | Incubation: 30Β°C, Assay: 60Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 150 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, FolinβCiocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase | Benzene | 60 % v/v | 100 | 104 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Na2HPO4βNaOH buffer, 5mM CoCl2 | Incubation: ?, Assay: 10 | Incubation: 30Β°C, Assay: 60Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 150 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, FolinβCiocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase | Chloroform | 60 % v/v | 100 | 120 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Na2HPO4βNaOH buffer, 5mM CoCl2 | Incubation: ?, Assay: 10 | Incubation: 30Β°C, Assay: 60Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 150 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, FolinβCiocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase | n-Hexadecane | 60 % v/v | 100 | 101 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Na2HPO4βNaOH buffer, 5mM CoCl2 | Incubation: ?, Assay: 10 | Incubation: 30Β°C, Assay: 60Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 150 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, FolinβCiocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase | 1-Butanol | 60 % v/v | 100 | 76 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Na2HPO4βNaOH buffer, 5mM CoCl2 | Incubation: ?, Assay: 10 | Incubation: 30Β°C, Assay: 60Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 150 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, FolinβCiocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase | Ethyl Acetate | 60 % v/v | 100 | 0 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Na2HPO4βNaOH buffer, 5mM CoCl2 | Incubation: ?, Assay: 10 | Incubation: 30Β°C, Assay: 60Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 150 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, FolinβCiocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase | Isopropanol | 60 % v/v | 100 | 121 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Na2HPO4βNaOH buffer, 5mM CoCl2 | Incubation: ?, Assay: 10 | Incubation: 30Β°C, Assay: 60Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 150 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, FolinβCiocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase | Isopropanol | 60 % v/v | 100 | 125 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Na2HPO4βNaOH buffer, 5mM CoCl2 | Incubation: ?, Assay: 10 | Incubation: 30Β°C, Assay: 60Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 150 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, FolinβCiocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase | Acetonitrile | 60 % v/v | 100 | 0 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Na2HPO4βNaOH buffer, 5mM CoCl2 | Incubation: ?, Assay: 10 | Incubation: 30Β°C, Assay: 60Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 150 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, FolinβCiocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase | Ethanol | 60 % v/v | 100 | 77 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Na2HPO4βNaOH buffer, 5mM CoCl2 | Incubation: ?, Assay: 10 | Incubation: 30Β°C, Assay: 60Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 150 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, FolinβCiocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase | Methanol | 60 % v/v | 100 | 83 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Na2HPO4βNaOH buffer, 5mM CoCl2 | Incubation: ?, Assay: 10 | Incubation: 30Β°C, Assay: 60Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 150 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, FolinβCiocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase | Dimethylformamide (DMF) | 60 % v/v | 100 | 135 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Na2HPO4βNaOH buffer, 5mM CoCl2 | Incubation: ?, Assay: 10 | Incubation: 30Β°C, Assay: 60Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 150 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at 30Β°C), measured by absorbance spectrophotometry (colorimetric assay, FolinβCiocalteu reaction product with free tyrsines absorbance measurement, 660 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 60 % v/v | 100 | 180 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM Na2HPO4βNaOH buffer, 5mM CoCl2 | Incubation: ?, Assay: 10 | Incubation: 30Β°C, Assay: 60Β°C | ? mM Casein | free amino acids , Peptides | β | Incubation: 150 rpm | Non-incubated control (in %), activity measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.