Protease (gene aprBG) from Bacillus gibsonii DSM8722
Enzyme Description
Species
Extremophile
Yes
"alkaliphilic" organism
EC Number
Sequence
MVGLVCVTALVTVTDSASAAEEKVKYLIGFEEEAELEAFTEEIDQVGVFSVEEQSVAEDTLDIDVDIIDEYDYTDVLAVELDPEDVDALSEEAGISFIEEDIELSIQQTVPWGITRVQAPAVHNRGITGSGVRVAILDSGISAHSDLNIRGGASFVPGEPTTADLNGHGTHVAGTVAALNNSIGVIGVAPNAELYAVKVLGANGSGSVSGIAQGLEWAATNNMHIANMSLGSDFPSSTLERAVNYATSRDVLVIAATGNNGSGSVGYPARYANAMAVGATDQNNRRANFSQYGTGIDIVAPGVNVQSTYPGNRYVSMNGTSMATPHVAGAAALVKQRYPSWNATQIRNHLKNTATNLGNSSQFGSGLVNAEAATR
Aihua Deng et al. (2014)
β Secretory Expression, Functional Characterization, and Molecular Genetic Analysis of Novel Halo-Solvent-Tolerant Protease from Bacillus gibsonii
Journal of Microbiology and Biotechnology
Β· doi:10.4014/jmb.1308.08094 β
Β· Stability - Incubation
▼
Database ID
UniProt: S5VEF0 β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Bacillus subtilis WB600
Experimental Data (44 measurements)
44 measurements β page 2 of 3
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase | Formamide | 10 % v/v | 100 | 102 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9.5 | Incubation: Room temperature, Assay: 75Β°C | 0.01 Azocasein | Azo-peptides , Peptides | β | β | Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase | Formamide | 50 % v/v | 100 | 87 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9.5 | Incubation: Room temperature, Assay: 75Β°C | 0.01 Azocasein | Azo-peptides , Peptides | β | β | Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase | Ethyl Acetate | 50 % v/v | 100 | 139 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9.5 | Incubation: Room temperature, Assay: 75Β°C | 0.01 Azocasein | Azo-peptides , Peptides | β | β | Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase | n-Hexane | 50 % v/v | 100 | 123 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9.5 | Incubation: Room temperature, Assay: 75Β°C | 0.01 Azocasein | Azo-peptides , Peptides | β | β | Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase | Xylene | 10 % v/v | 100 | 114 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9.5 | Incubation: Room temperature, Assay: 75Β°C | 0.01 Azocasein | Azo-peptides , Peptides | β | β | Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase | Xylene | 50 % v/v | 100 | 125 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9.5 | Incubation: Room temperature, Assay: 75Β°C | 0.01 Azocasein | Azo-peptides , Peptides | β | β | Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase | Toluene | 10 % v/v | 100 | 102 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9.5 | Incubation: Room temperature, Assay: 75Β°C | 0.01 Azocasein | Azo-peptides , Peptides | β | β | Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase | Toluene | 50 % v/v | 100 | 111 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9.5 | Incubation: Room temperature, Assay: 75Β°C | 0.01 Azocasein | Azo-peptides , Peptides | β | β | Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase | Benzene | 10 % v/v | 100 | 125 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9.5 | Incubation: Room temperature, Assay: 75Β°C | 0.01 Azocasein | Azo-peptides , Peptides | β | β | Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase | Benzene | 50 % v/v | 100 | 136 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9.5 | Incubation: Room temperature, Assay: 75Β°C | 0.01 Azocasein | Azo-peptides , Peptides | β | β | Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase | 1-Butanol | 10 % v/v | 100 | 112 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9.5 | Incubation: Room temperature, Assay: 75Β°C | 0.01 Azocasein | Azo-peptides , Peptides | β | β | Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase | 1-Butanol | 50 % v/v | 100 | 104 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9.5 | Incubation: Room temperature, Assay: 75Β°C | 0.01 Azocasein | Azo-peptides , Peptides | β | β | Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase | Ethyl Acetate | 10 % v/v | 100 | 108 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9.5 | Incubation: Room temperature, Assay: 75Β°C | 0.01 Azocasein | Azo-peptides , Peptides | β | β | Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase | n-Hexane | 10 % v/v | 100 | 93 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9.5 | Incubation: Room temperature, Assay: 75Β°C | 0.01 Azocasein | Azo-peptides , Peptides | β | β | Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase | Isopropanol | 10 % v/v | 100 | 126 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9.5 | Incubation: Room temperature, Assay: 75Β°C | 0.01 Azocasein | Azo-peptides , Peptides | β | β | Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase | Isopropanol | 50 % v/v | 100 | 141 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9.5 | Incubation: Room temperature, Assay: 75Β°C | 0.01 Azocasein | Azo-peptides , Peptides | β | β | Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase | Acetone | 10 % v/v | 100 | 122 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9.5 | Incubation: Room temperature, Assay: 75Β°C | 0.01 Azocasein | Azo-peptides , Peptides | β | β | Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase | Acetone | 50 % v/v | 100 | 125 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9.5 | Incubation: Room temperature, Assay: 75Β°C | 0.01 Azocasein | Azo-peptides , Peptides | β | β | Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase | Ethanol | 10 % v/v | 100 | 112 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9.5 | Incubation: Room temperature, Assay: 75Β°C | 0.01 Azocasein | Azo-peptides , Peptides | β | β | Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase | Ethanol | 50 % v/v | 100 | 107 | % | Direct | Continuous | Incubation: ?, Assay: 50 mM glycine-NaOH buffer | Incubation: ?, Assay: 9.5 | Incubation: Room temperature, Assay: 75Β°C | 0.01 Azocasein | Azo-peptides , Peptides | β | β | Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.