Protease (gene aprBG) from Bacillus gibsonii DSM8722

Enzyme Description

Extremophile
Yes "alkaliphilic" organism
EC Number

Sequence

Length: 375 amino acids
MVGLVCVTALVTVTDSASAAEEKVKYLIGFEEEAELEAFTEEIDQVGVFSVEEQSVAEDTLDIDVDIIDEYDYTDVLAVELDPEDVDALSEEAGISFIEEDIELSIQQTVPWGITRVQAPAVHNRGITGSGVRVAILDSGISAHSDLNIRGGASFVPGEPTTADLNGHGTHVAGTVAALNNSIGVIGVAPNAELYAVKVLGANGSGSVSGIAQGLEWAATNNMHIANMSLGSDFPSSTLERAVNYATSRDVLVIAATGNNGSGSVGYPARYANAMAVGATDQNNRRANFSQYGTGIDIVAPGVNVQSTYPGNRYVSMNGTSMATPHVAGAAALVKQRYPSWNATQIRNHLKNTATNLGNSSQFGSGLVNAEAATR
Aihua Deng et al. (2014) β€” Secretory Expression, Functional Characterization, and Molecular Genetic Analysis of Novel Halo-Solvent-Tolerant Protease from Bacillus gibsonii
Journal of Microbiology and Biotechnology  Β· doi:10.4014/jmb.1308.08094 β†—  Β· Stability - Incubation
44 measurements
Database ID
UniProt: S5VEF0 β†—
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Bacillus subtilis WB600

Experimental Data (44 measurements)

44 measurements β€” page 3 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 10 % v/v 100 94 % Direct Continuous Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 0.01 Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 50 % v/v 100 98 % Direct Continuous Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 0.01 Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase Formamide 10 % v/v 100 117 % Direct Continuous Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 0.01 Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 day at room temperature), measured by absorbance spectrophotometry (colorimetric assay, free azo-dye absorbance measurement, 366 nm) in aqueous phase Formamide 50 % v/v 100 114 % Direct Continuous Incubation: ?, Assay: 50 mM glycine-NaOH buffer Incubation: ?, Assay: 9.5 Incubation: Room temperature, Assay: 75Β°C 0.01 Azocasein Azo-peptides , Peptides β€” β€” Water-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
1 2 3
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*