Azoreductase (gene GtAZR) from Geobacillus thermoglucosidasius C56-Y593

Enzyme Description

Species
Geobacillus thermoglucosidasius C56-Y593 β†—
Extremophile
Yes "thermophilic" organism
EC Number
1.7.1.6 β†—

Sequence

Length: 289 amino acids
MFMSIAVTGATGQLGGLVIQHLLKKVPASQIIAIARNVEKASALADQGVEVRHGDYDDPKSLEKAFAGASKLLFISSPDTDNTLRVVQHANVVKAARDAGVKHIAYTGYAFAEEATLPLAHVHLATEYAIRTTNIPYTFLRNALYTELFINEGLRASVESGAVVTNTGNGRINSVTRNDLALAAVTVLTEEGHENKTYNLVSNQPWNFDDLAQILSEVSGKKVVHQSVSFEEEKNILVNAGVPEPFAELTAAIYDAVSKGETSKTSDDLQKLIGSLTPLKETVKQALQI
Fen Gao et al. (2014) β€” Molecular characterization of a novel thermal stable reductase capable of decoloration of both azo and triphenylmethane dyes
Applied Microbiology and Biotechnology  Β· doi:10.1007/s00253-014-5896-z β†—  Β· Stability - Incubation
40 measurements ▼
Database ID
UniProt: A0A024K767 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (40 measurements)

40 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Acetone 70 % v/v 100 84 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Ethanol 60 % v/v 100 21 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Ethanol 70 % v/v 100 20 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Ethanol 80 % v/v 100 18 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Acetone 10 % v/v 100 112 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Acetone 20 % v/v 100 106 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Acetone 30 % v/v 100 106 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Acetone 40 % v/v 100 100 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Acetone 50 % v/v 100 82 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Acetone 60 % v/v 100 74 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Ethanol 50 % v/v 100 71 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Acetone 80 % v/v 100 88 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Acetonitrile 10 % v/v 100 105 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Acetonitrile 20 % v/v 100 109 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Acetonitrile 30 % v/v 100 116 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Acetonitrile 40 % v/v 100 88 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Acetonitrile 50 % v/v 100 88 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Acetonitrile 60 % v/v 100 80 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Acetonitrile 70 % v/v 100 56 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Acetonitrile 80 % v/v 100 57 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
β€Ή Prev
1 2
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*