Azoreductase (gene GtAZR) from Geobacillus thermoglucosidasius C56-Y593

Enzyme Description

Species
Geobacillus thermoglucosidasius C56-Y593 β†—
Extremophile
Yes "thermophilic" organism
EC Number
1.7.1.6 β†—

Sequence

Length: 289 amino acids
MFMSIAVTGATGQLGGLVIQHLLKKVPASQIIAIARNVEKASALADQGVEVRHGDYDDPKSLEKAFAGASKLLFISSPDTDNTLRVVQHANVVKAARDAGVKHIAYTGYAFAEEATLPLAHVHLATEYAIRTTNIPYTFLRNALYTELFINEGLRASVESGAVVTNTGNGRINSVTRNDLALAAVTVLTEEGHENKTYNLVSNQPWNFDDLAQILSEVSGKKVVHQSVSFEEEKNILVNAGVPEPFAELTAAIYDAVSKGETSKTSDDLQKLIGSLTPLKETVKQALQI
Fen Gao et al. (2014) β€” Molecular characterization of a novel thermal stable reductase capable of decoloration of both azo and triphenylmethane dyes
Applied Microbiology and Biotechnology  Β· doi:10.1007/s00253-014-5896-z β†—  Β· Stability - Incubation
40 measurements ▼
Database ID
UniProt: A0A024K767 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (40 measurements)

40 measurements β€” page 2 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Methanol 30 % v/v 100 110 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 20 % v/v 100 107 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 30 % v/v 100 96 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 40 % v/v 100 100 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 50 % v/v 100 98 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 60 % v/v 100 79 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 70 % v/v 100 47 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 80 % v/v 100 22 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Methanol 10 % v/v 100 108 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Methanol 20 % v/v 100 112 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 10 % v/v 100 110 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Methanol 40 % v/v 100 107 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Methanol 50 % v/v 100 104 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Methanol 60 % v/v 100 80 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Methanol 70 % v/v 100 40 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Methanol 80 % v/v 100 18 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Ethanol 10 % v/v 100 118 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Ethanol 20 % v/v 100 104 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Ethanol 30 % v/v 100 106 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 25Β°C), measured by absorbance spectrophotometry (decrease in Methyl red absorbance measurement, 430 nm) in aqueous phase Ethanol 40 % v/v 100 98 % Digital Continuous Incubation: 100 mM sodium phosphate buffer, Assay: 100 mM sodium phosphate buffer Incubation: 7, Assay: 7 Incubation: 25Β°C, Assay: 25Β°C 0.1 mM Methyl red Reduced amine products from Methyl red 0.2 mM NADH β€” Non-incubated control (in %), assay measured in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent
β€Ή Prev
1 2
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*