Esterase from Shewanella sp.
Enzyme Description
Species
Extremophile
No
but "cold-adapted", "halotolerant" enzyme
EC Number
Sequence
MSSATLDAVVVEPREPATACVIWLHGLGDSGDGFAPVVPALGLPADHSIRFVFPHAPEQAVTVNGGYVMRAWYDIKSLNLHDRADMPGVLQSERLVRQLIEQQVAQGIAANRIVLAGFSQGGVMSLFTALRYPEALAGIMALSCYLPGGEQLPEDVSSANRDTPILQCHGEQDDVVALSAGLMAKEALEQGGYRLEWHTFPMAHGVVPQELNLISQWLQARLS
Yian Hang et al. (2016)
β Mutational analysis and stability characterization of a novel esterase of lipolytic enzyme family VI from Shewanella sp
International Journal of Biological Macromolecules
Β· doi:10.1016/j.ijbiomac.2016.09.032 β
Β· Activity - Classical
▼
Database ID
UniProt: A0A380BYZ7 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (24 measurements)
24 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100.0 | 113.49 | % | Direct | Continuous | 50 mM phosphate-citrate buffer | 8 | 30Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 30 % v/v | 100.0 | 0.0 | % | Direct | Continuous | 50 mM phosphate-citrate buffer | 8 | 30Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 20 % v/v | 100.0 | 0.0 | % | Direct | Continuous | 50 mM phosphate-citrate buffer | 8 | 30Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetonitrile | 10 % v/v | 100.0 | 65.0 | % | Direct | Continuous | 50 mM phosphate-citrate buffer | 8 | 30Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 30 % v/v | 100.0 | 3.41 | % | Direct | Continuous | 50 mM phosphate-citrate buffer | 8 | 30Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 20 % v/v | 100.0 | 30.48 | % | Direct | Continuous | 50 mM phosphate-citrate buffer | 8 | 30Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Isopropanol | 10 % v/v | 100.0 | 89.63 | % | Direct | Continuous | 50 mM phosphate-citrate buffer | 8 | 30Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethylene Glycol | 30 % v/v | 100.0 | 125.06 | % | Direct | Continuous | 50 mM phosphate-citrate buffer | 8 | 30Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethylene Glycol | 20 % v/v | 100.0 | 94.01 | % | Direct | Continuous | 50 mM phosphate-citrate buffer | 8 | 30Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethylene Glycol | 10 % v/v | 100.0 | 92.48 | % | Direct | Continuous | 50 mM phosphate-citrate buffer | 8 | 30Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 30 % v/v | 100.0 | 50.02 | % | Direct | Continuous | 50 mM phosphate-citrate buffer | 8 | 30Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Dimethyl Sulfoxide (DMSO) | 20 % v/v | 100.0 | 75.15 | % | Direct | Continuous | 50 mM phosphate-citrate buffer | 8 | 30Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Acetone | 10 % v/v | 100.0 | 55.52 | % | Direct | Continuous | 50 mM phosphate-citrate buffer | 8 | 30Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 30 % v/v | 100.0 | 19.94 | % | Direct | Continuous | 50 mM phosphate-citrate buffer | 8 | 30Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 20 % v/v | 100.0 | 107.09 | % | Direct | Continuous | 50 mM phosphate-citrate buffer | 8 | 30Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Ethanol | 10 % v/v | 100.0 | 95.35 | % | Direct | Continuous | 50 mM phosphate-citrate buffer | 8 | 30Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 30 % v/v | 100.0 | 74.11 | % | Direct | Continuous | 50 mM phosphate-citrate buffer | 8 | 30Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 20 % v/v | 100.0 | 111.01 | % | Direct | Continuous | 50 mM phosphate-citrate buffer | 8 | 30Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | Methanol | 10 % v/v | 100.0 | 101.16 | % | Direct | Continuous | 50 mM phosphate-citrate buffer | 8 | 30Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
| Activity - Classical | Activity measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in the presence of organic solvent | 1-Butanol | 30 % v/v | 100.0 | 0.91 | % | Direct | Continuous | 50 mM phosphate-citrate buffer | 8 | 30Β°C | 0.1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Classical aqueous control (in %) |
Visualization : Activity β Classical
One bar per measurement. Colour = solvent, shade = solvent volume.