C-terminal truncated lipase from Staphylococcus epidermis AT2
Enzyme Description
Sequence
INQLTAQAQYKNQYPVVFVHGFVGLVGEDSFSMYPNYWGGTKYNVKQELTKLGYRVHEANVGAFSSNYDRAVELYYYIKGGRVDYGAAHAAKYGHKRYGRTYEGIMPDWEPGKKIHLVGHSMGGQTIRLMEHFLRNGNQEEIDYQRQYGGTVSDLFKGGQDNMVSTITTLGTPHNGTPAADKLGSTKFIKDTINRIGKIGGTKALDLELGFSQWGFKQKPNESYAEYAKRIANSKVWETEDQAVNDLTTAGAEKLNQMTTLNPNIVYTSYTGAATHTGPLGNEVPNIRQFPLFDLTSRAIGGDDNKNVRVNDGIVPVSSSLHPSDEAFKKVGMMNLATDKGIWQVRPVQYDWDHLDLVGLDTTDYKRTGEELGQFYMSMINNMLKVEELDGITRK
Jiivittha Veno et al. (2017)
β Directed Evolution of Recombinant C-Terminal Truncated Staphylococcus epidermidis Lipase AT2 for the Enhancement of Thermostability
International Journal of Molecular Sciences
Β· doi:10.3390/ijms18112202 β
Β· Stability - Incubation
▼
Database ID
UniProt: B5A5A8 β
Sequence Annotation
Inferred - from protein name (248 first residues from UniProt sequence absent from the mature protein)
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (32 measurements)
32 measurements β page 1 of 2
| Mutation | Property | Assay | Solvent | Solvent Volume | Aqueous Reference | WT Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| WT | Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | 1-Propanol | 50 % v/v | 100 | β | 0 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic | Incubation: ?, Assay: 8 | Incubation: 50Β°C, Assay: 25Β°C | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| WT | Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Toluene | 50 % v/v | 100 | β | 0 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic | Incubation: ?, Assay: 8 | Incubation: 50Β°C, Assay: 25Β°C | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| WT | Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | 1-Octanol | 50 % v/v | 100 | β | 0 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic | Incubation: ?, Assay: 8 | Incubation: 50Β°C, Assay: 25Β°C | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| WT | Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Benzene | 50 % v/v | 100 | β | 0 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic | Incubation: ?, Assay: 8 | Incubation: 50Β°C, Assay: 25Β°C | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| WT | Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Chloroform | 50 % v/v | 100 | β | 0 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic | Incubation: ?, Assay: 8 | Incubation: 50Β°C, Assay: 25Β°C | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| WT | Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | p-Xylene | 50 % v/v | 100 | β | 0 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic | Incubation: ?, Assay: 8 | Incubation: 50Β°C, Assay: 25Β°C | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| WT | Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Diethyl Ether | 50 % v/v | 100 | β | 225 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic | Incubation: ?, Assay: 8 | Incubation: 50Β°C, Assay: 25Β°C | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| WT | Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Isopropanol | 50 % v/v | 100 | β | 137 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic | Incubation: ?, Assay: 8 | Incubation: 50Β°C, Assay: 25Β°C | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| WT | Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | n-Hexane | 50 % v/v | 100 | β | 0 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic | Incubation: ?, Assay: 8 | Incubation: 50Β°C, Assay: 25Β°C | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| WT | Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Acetone | 50 % v/v | 100 | β | 26 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic | Incubation: ?, Assay: 8 | Incubation: 50Β°C, Assay: 25Β°C | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| WT | Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | n-Heptane | 50 % v/v | 100 | β | 0 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic | Incubation: ?, Assay: 8 | Incubation: 50Β°C, Assay: 25Β°C | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| WT | Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Ethanol | 50 % v/v | 100 | β | 12 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic | Incubation: ?, Assay: 8 | Incubation: 50Β°C, Assay: 25Β°C | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| WT | Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Acetonitrile | 50 % v/v | 100 | β | 0 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic | Incubation: ?, Assay: 8 | Incubation: 50Β°C, Assay: 25Β°C | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| WT | Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | n-Hexadecane | 50 % v/v | 100 | β | 0 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic | Incubation: ?, Assay: 8 | Incubation: 50Β°C, Assay: 25Β°C | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| WT | Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Methanol | 50 % v/v | 100 | β | 110 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic | Incubation: ?, Assay: 8 | Incubation: 50Β°C, Assay: 25Β°C | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| WT | Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 50 % v/v | 100 | β | 181 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic | Incubation: ?, Assay: 8 | Incubation: 50Β°C, Assay: 25Β°C | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| G210C | Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | n-Hexane | 50 % v/v | 100 | 0 | 59 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic | Incubation: ?, Assay: 8 | Incubation: 50Β°C, Assay: 45Β°C | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| G210C | Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | n-Hexadecane | 50 % v/v | 100 | 0 | 23 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic | Incubation: ?, Assay: 8 | Incubation: 50Β°C, Assay: 45Β°C | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| G210C | Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | p-Xylene | 50 % v/v | 100 | 0 | 55 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic | Incubation: ?, Assay: 8 | Incubation: 50Β°C, Assay: 45Β°C | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
| G210C | Stability - Incubation | Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase | n-Heptane | 50 % v/v | 100 | 0 | 33 | % | Digital | Continuous | Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic | Incubation: ?, Assay: 8 | Incubation: 50Β°C, Assay: 45Β°C | 0.6 mM p-Nitrophenyl palmitate | p-Nitrophenol , Palmitic Acid | β | β | Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent |
Mutations in this dataset (2)
WT
G210C
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume. β β β Reference value. Hover for details.
Mutation Effect
Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.