C-terminal truncated lipase from Staphylococcus epidermis AT2

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 395 amino acids
INQLTAQAQYKNQYPVVFVHGFVGLVGEDSFSMYPNYWGGTKYNVKQELTKLGYRVHEANVGAFSSNYDRAVELYYYIKGGRVDYGAAHAAKYGHKRYGRTYEGIMPDWEPGKKIHLVGHSMGGQTIRLMEHFLRNGNQEEIDYQRQYGGTVSDLFKGGQDNMVSTITTLGTPHNGTPAADKLGSTKFIKDTINRIGKIGGTKALDLELGFSQWGFKQKPNESYAEYAKRIANSKVWETEDQAVNDLTTAGAEKLNQMTTLNPNIVYTSYTGAATHTGPLGNEVPNIRQFPLFDLTSRAIGGDDNKNVRVNDGIVPVSSSLHPSDEAFKKVGMMNLATDKGIWQVRPVQYDWDHLDLVGLDTTDYKRTGEELGQFYMSMINNMLKVEELDGITRK
Jiivittha Veno et al. (2017) β€” Directed Evolution of Recombinant C-Terminal Truncated Staphylococcus epidermidis Lipase AT2 for the Enhancement of Thermostability
International Journal of Molecular Sciences  Β· doi:10.3390/ijms18112202 β†—  Β· Stability - Incubation
32 measurements
Database ID
UniProt: B5A5A8 β†—
Sequence Annotation
Inferred - from protein name (248 first residues from UniProt sequence absent from the mature protein)
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (32 measurements)

32 measurements β€” page 2 of 2
Mutation Property Assay Solvent Solvent Volume Aqueous ReferenceWT Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
G210C Stability - Incubation Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase 1-Octanol 50 % v/v 100 0 37 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic Incubation: ?, Assay: 8 Incubation: 50Β°C, Assay: 45Β°C 0.6 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C Stability - Incubation Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Toluene 50 % v/v 100 0 53 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic Incubation: ?, Assay: 8 Incubation: 50Β°C, Assay: 45Β°C 0.6 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C Stability - Incubation Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Benzene 50 % v/v 100 0 74 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic Incubation: ?, Assay: 8 Incubation: 50Β°C, Assay: 45Β°C 0.6 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C Stability - Incubation Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Chloroform 50 % v/v 100 48 48 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic Incubation: ?, Assay: 8 Incubation: 50Β°C, Assay: 45Β°C 0.6 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C Stability - Incubation Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Diethyl Ether 50 % v/v 100 225 418 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic Incubation: ?, Assay: 8 Incubation: 50Β°C, Assay: 45Β°C 0.6 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C Stability - Incubation Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Isopropanol 50 % v/v 100 137 322 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic Incubation: ?, Assay: 8 Incubation: 50Β°C, Assay: 45Β°C 0.6 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C Stability - Incubation Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase 1-Propanol 50 % v/v 100 0 60 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic Incubation: ?, Assay: 8 Incubation: 50Β°C, Assay: 45Β°C 0.6 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C Stability - Incubation Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetone 50 % v/v 100 26 145 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic Incubation: ?, Assay: 8 Incubation: 50Β°C, Assay: 45Β°C 0.6 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C Stability - Incubation Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Ethanol 50 % v/v 100 12 106 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic Incubation: ?, Assay: 8 Incubation: 50Β°C, Assay: 45Β°C 0.6 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C Stability - Incubation Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Acetonitrile 50 % v/v 100 0 47 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic Incubation: ?, Assay: 8 Incubation: 50Β°C, Assay: 45Β°C 0.6 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C Stability - Incubation Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Methanol 50 % v/v 100 110 266 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic Incubation: ?, Assay: 8 Incubation: 50Β°C, Assay: 45Β°C 0.6 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
G210C Stability - Incubation Activity after incubation (30 minutes at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 410 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 50 % v/v 100 181 297 % Digital Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer, 0.1% gum arabic Incubation: ?, Assay: 8 Incubation: 50Β°C, Assay: 45Β°C 0.6 mM p-Nitrophenyl palmitate p-Nitrophenol , Palmitic Acid β€” β€” Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent
1 2
Next β€Ί

Mutations in this dataset (2)

WT G210C

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume. β€” β€” β€” Reference value. Hover for details.

Mutation Effect

Mutation impact on enzyme stability and function in the presence of organic solvent: comparison of wild-type and mutant values in identical conditions.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*