Esterase (gene estUT1) from Ureibacillus thermosphaericus UT1
Enzyme Description
Extremophile
Yes
"thermophilic" organism
EC Number
Sequence
MKIVSPKPFTIETGKRAVLLLHGFTGNTNDVKRLGRYLADRNYTVHAPLYKGHGSDPLTLINTDPIEWWNSAVEGYDELRRRGYKEIAVAGVSLGGIFSLRLGEERPIKAIVTMSAPALSKSVDSLQQRIISYTINYKKLTGTYNEDVDKPENLAKTYRMPKLEYLQGIINDTSAKLNQIDKPVHILRGLNDDEYYCQSADYIYNSVKSRIKSVKSFINSGHILTVDKERDLVFEEVYRFFESLKWEE
Yuliya V. Samoylova et al. (2018)
β Cloning, expression and characterization of the esterase estUT1 from Ureibacillus thermosphaericus which belongs to a new lipase family XVIII
Extremophiles
Β· doi:10.1007/s00792-018-0996-9 β
Β· Stability - Incubation
▼
Database ID
UniProt: A0A223PZA8 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (32 measurements)
32 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 10 % v/v | 100 | 124 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol | Incubation: 8, Assay: 8 | Incubation: 50Β°C, Assay: 50Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 30 % v/v | 100 | 18 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol | Incubation: 8, Assay: 8 | Incubation: 50Β°C, Assay: 50Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (6 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 30 % v/v | 100 | 66 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol | Incubation: 8, Assay: 8 | Incubation: 50Β°C, Assay: 50Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (3 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 30 % v/v | 100 | 73 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol | Incubation: 8, Assay: 8 | Incubation: 50Β°C, Assay: 50Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 30 % v/v | 100 | 130 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol | Incubation: 8, Assay: 8 | Incubation: 50Β°C, Assay: 50Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 10 % v/v | 100 | 6 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol | Incubation: 8, Assay: 8 | Incubation: 50Β°C, Assay: 50Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (6 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 10 % v/v | 100 | 73 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol | Incubation: 8, Assay: 8 | Incubation: 50Β°C, Assay: 50Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (3 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 10 % v/v | 100 | 101 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol | Incubation: 8, Assay: 8 | Incubation: 50Β°C, Assay: 50Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Ethanol | 10 % v/v | 100 | 116 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol | Incubation: 8, Assay: 8 | Incubation: 50Β°C, Assay: 50Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 30 % v/v | 100 | 36 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol | Incubation: 8, Assay: 8 | Incubation: 50Β°C, Assay: 50Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (6 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 30 % v/v | 100 | 86 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol | Incubation: 8, Assay: 8 | Incubation: 50Β°C, Assay: 50Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (3 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 30 % v/v | 100 | 104 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol | Incubation: 8, Assay: 8 | Incubation: 50Β°C, Assay: 50Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 30 % v/v | 100 | 142 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol | Incubation: 8, Assay: 8 | Incubation: 50Β°C, Assay: 50Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (24 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 10 % v/v | 100 | 17 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol | Incubation: 8, Assay: 8 | Incubation: 50Β°C, Assay: 50Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (6 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 10 % v/v | 100 | 71 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol | Incubation: 8, Assay: 8 | Incubation: 50Β°C, Assay: 50Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (3 hours at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Methanol | 10 % v/v | 100 | 76 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol | Incubation: 8, Assay: 8 | Incubation: 50Β°C, Assay: 50Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | n-Hexane | 10 % v/v | 100 | 117 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol | Incubation: 8, Assay: 8 | Incubation: 50Β°C, Assay: 50Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethylformamide (DMF) | 30 % v/v | 100 | 101 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol | Incubation: 8, Assay: 8 | Incubation: 50Β°C, Assay: 50Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Dimethylformamide (DMF) | 10 % v/v | 100 | 113 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol | Incubation: 8, Assay: 8 | Incubation: 50Β°C, Assay: 50Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
| Stability - Incubation | Activity after incubation (1 hour at 50Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase | Acetonitrile | 30 % v/v | 100 | 90 | % | Digital | Continuous | Incubation: 50 mM Tris-HCl buffer, Assay: 50 mM Tris-HCl buffer, 1% acetonitrile, 4% Ethanol | Incubation: 8, Assay: 8 | Incubation: 50Β°C, Assay: 50Β°C | 1 mM p-Nitrophenyl butyrate | Butyric Acid , p-Nitrophenol | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.