Esterase (gene EstSP) from a Goa solar saltern metagenomic library

Enzyme Description

Species
Na (Goa solar saltern metagenomic library)
Extremophile
Yes probably halophilic organism (solar saltern), halotolerant enzyme
EC Number

Sequence

Length: 337 amino acids
MLGGLEQPMLHQIADVDSREEALAIANSESALAEEAALIELMQAMDDESVHSSAGLVISEHHINSEPDNNSINVRVIRPDTDAVLPCILYLHGGAMMSMSYDLGTYRAWGKVLAQQGICVAMVDFRNSLRPSTTEEVAPFPAGLNDCVSGYHWVRTNASALKIDPESVLIAGDSGGGNLAIATTMRLVDAGQPPLGLYALCPYILGQWPNADYPSSEEFEGYLISVHNNHATMAYGIEAFERRDRYAWPGFATAENLQGFPPSMISVNECDPLRDEGIAFYRKLLEAGVQAHCRQLMGTVHANEMFTTVFPELTRMTARDMVGWVRECQLLTGSAPA
G. Jayanath et al. (2018) β€” A novel solvent tolerant esterase of GDSGG motif subfamily from solar saltern through metagenomic approach: Recombinant expression and characterization
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2018.06.057 β†—  Β· Stability - Incubation
64 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli Rosetta-gami B(DE3) pLysS

Experimental Data (64 measurements)

64 measurements β€” page 4 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethylformamide (DMF) 10 % v/v 100.0 48.32 % Direct Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethylformamide (DMF) 20 % v/v 100.0 28.52 % Direct Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Hexane 10 % v/v 100.0 112.33 % Direct Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (24 hours at 25Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Hexane 20 % v/v 100.0 82.98 % Direct Continuous Incubation: ?, Assay: 50 mM Tris-HCl buffer Incubation: ?, Assay: 8 Incubation: 25Β°C, Assay: 40Β°C 1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay in aqueous phase
1 2 3 4
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*