Azoreductase (gene AzoRed2) from Streptomyces sp. S27

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 233 amino acids
VPRLLHLDSSARTDSFTRRLGAAFVRAWRLNGGGEVTHRDLAIDPPPPISEGWTSLCDTLLREGITEAATDHYAQAVRTEAERRAWAVTEPLLAELLAADVVLIGAPMYNFGVPAALKAWIDQVTFPKMVLAPRRFVVLSARGGAYGPGTPREPFDHQGRYLLDFFHGHYGVEDAEVISAELVNSLSDPGLAGRLPQHLDSAAAALARAVELGTELATVPATTSADRTLAKEG
Hao Dong et al. (2019) β€” Biochemical characterization of a novel azoreductase from Streptomyces sp.: Application in eco-friendly decolorization of azo dye wastewater
International Journal of Biological Macromolecules  Β· doi:10.1016/j.ijbiomac.2019.08.196 β†—  Β· Stability - Incubation
22 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (22 measurements)

22 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 20 % v/v 100.0 100.0 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase Isooctane 20 % v/v 100.0 91.99 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase n-Hexane 20 % v/v 100.0 92.33 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase Chloroform 20 % v/v 100.0 12.2 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase Isoamyl Alcohol 20 % v/v 100.0 9.76 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase 1-Butanol 20 % v/v 100.0 6.27 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase 1-Propanol 20 % v/v 100.0 23.73 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase Isopropanol 20 % v/v 100.0 109.32 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase Acetonitrile 20 % v/v 100.0 17.8 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase Ethanol 20 % v/v 100.0 105.93 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase Methanol 20 % v/v 100.0 100.0 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 10 % v/v 100.0 85.28 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase Isooctane 10 % v/v 100.0 69.03 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase n-Hexane 10 % v/v 100.0 103.73 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase Chloroform 10 % v/v 100.0 10.82 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase Isoamyl Alcohol 10 % v/v 100.0 13.06 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase 1-Butanol 10 % v/v 100.0 13.06 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase 1-Propanol 10 % v/v 100.0 84.05 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase Isopropanol 10 % v/v 100.0 87.73 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
Stability - Incubation Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase Acetonitrile 10 % v/v 100.0 48.47 % Direct Continuous Incubation: ?, Assay: 25 mM Tris-HCl buffer Incubation: ?, Assay: 7.4 Incubation: 30Β°C, Assay: 30Β°C 25 Β΅M Methyl red N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid 250 Β΅M NADH, 5 Β΅M FMN Incubation: 80 rpm Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents
β€Ή Prev
1 2

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*