Azoreductase (gene AzoRed2) from Streptomyces sp. S27
Enzyme Description
Sequence
VPRLLHLDSSARTDSFTRRLGAAFVRAWRLNGGGEVTHRDLAIDPPPPISEGWTSLCDTLLREGITEAATDHYAQAVRTEAERRAWAVTEPLLAELLAADVVLIGAPMYNFGVPAALKAWIDQVTFPKMVLAPRRFVVLSARGGAYGPGTPREPFDHQGRYLLDFFHGHYGVEDAEVISAELVNSLSDPGLAGRLPQHLDSAAAALARAVELGTELATVPATTSADRTLAKEG
Hao Dong et al. (2019)
β Biochemical characterization of a novel azoreductase from Streptomyces sp.: Application in eco-friendly decolorization of azo dye wastewater
International Journal of Biological Macromolecules
Β· doi:10.1016/j.ijbiomac.2019.08.196 β
Β· Stability - Incubation
▼
Database ID
UniParc: UPI0012A9B19E β
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (22 measurements)
22 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 20 % v/v | 100.0 | 100.0 | % | Direct | Continuous | Incubation: ?, Assay: 25 mM Tris-HCl buffer | Incubation: ?, Assay: 7.4 | Incubation: 30Β°C, Assay: 30Β°C | 25 Β΅M Methyl red | N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid | 250 Β΅M NADH, 5 Β΅M FMN | Incubation: 80 rpm | Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase | Isooctane | 20 % v/v | 100.0 | 91.99 | % | Direct | Continuous | Incubation: ?, Assay: 25 mM Tris-HCl buffer | Incubation: ?, Assay: 7.4 | Incubation: 30Β°C, Assay: 30Β°C | 25 Β΅M Methyl red | N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid | 250 Β΅M NADH, 5 Β΅M FMN | Incubation: 80 rpm | Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase | n-Hexane | 20 % v/v | 100.0 | 92.33 | % | Direct | Continuous | Incubation: ?, Assay: 25 mM Tris-HCl buffer | Incubation: ?, Assay: 7.4 | Incubation: 30Β°C, Assay: 30Β°C | 25 Β΅M Methyl red | N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid | 250 Β΅M NADH, 5 Β΅M FMN | Incubation: 80 rpm | Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase | Chloroform | 20 % v/v | 100.0 | 12.2 | % | Direct | Continuous | Incubation: ?, Assay: 25 mM Tris-HCl buffer | Incubation: ?, Assay: 7.4 | Incubation: 30Β°C, Assay: 30Β°C | 25 Β΅M Methyl red | N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid | 250 Β΅M NADH, 5 Β΅M FMN | Incubation: 80 rpm | Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase | Isoamyl Alcohol | 20 % v/v | 100.0 | 9.76 | % | Direct | Continuous | Incubation: ?, Assay: 25 mM Tris-HCl buffer | Incubation: ?, Assay: 7.4 | Incubation: 30Β°C, Assay: 30Β°C | 25 Β΅M Methyl red | N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid | 250 Β΅M NADH, 5 Β΅M FMN | Incubation: 80 rpm | Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase | 1-Butanol | 20 % v/v | 100.0 | 6.27 | % | Direct | Continuous | Incubation: ?, Assay: 25 mM Tris-HCl buffer | Incubation: ?, Assay: 7.4 | Incubation: 30Β°C, Assay: 30Β°C | 25 Β΅M Methyl red | N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid | 250 Β΅M NADH, 5 Β΅M FMN | Incubation: 80 rpm | Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase | 1-Propanol | 20 % v/v | 100.0 | 23.73 | % | Direct | Continuous | Incubation: ?, Assay: 25 mM Tris-HCl buffer | Incubation: ?, Assay: 7.4 | Incubation: 30Β°C, Assay: 30Β°C | 25 Β΅M Methyl red | N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid | 250 Β΅M NADH, 5 Β΅M FMN | Incubation: 80 rpm | Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase | Isopropanol | 20 % v/v | 100.0 | 109.32 | % | Direct | Continuous | Incubation: ?, Assay: 25 mM Tris-HCl buffer | Incubation: ?, Assay: 7.4 | Incubation: 30Β°C, Assay: 30Β°C | 25 Β΅M Methyl red | N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid | 250 Β΅M NADH, 5 Β΅M FMN | Incubation: 80 rpm | Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase | Acetonitrile | 20 % v/v | 100.0 | 17.8 | % | Direct | Continuous | Incubation: ?, Assay: 25 mM Tris-HCl buffer | Incubation: ?, Assay: 7.4 | Incubation: 30Β°C, Assay: 30Β°C | 25 Β΅M Methyl red | N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid | 250 Β΅M NADH, 5 Β΅M FMN | Incubation: 80 rpm | Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase | Ethanol | 20 % v/v | 100.0 | 105.93 | % | Direct | Continuous | Incubation: ?, Assay: 25 mM Tris-HCl buffer | Incubation: ?, Assay: 7.4 | Incubation: 30Β°C, Assay: 30Β°C | 25 Β΅M Methyl red | N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid | 250 Β΅M NADH, 5 Β΅M FMN | Incubation: 80 rpm | Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase | Methanol | 20 % v/v | 100.0 | 100.0 | % | Direct | Continuous | Incubation: ?, Assay: 25 mM Tris-HCl buffer | Incubation: ?, Assay: 7.4 | Incubation: 30Β°C, Assay: 30Β°C | 25 Β΅M Methyl red | N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid | 250 Β΅M NADH, 5 Β΅M FMN | Incubation: 80 rpm | Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100.0 | 85.28 | % | Direct | Continuous | Incubation: ?, Assay: 25 mM Tris-HCl buffer | Incubation: ?, Assay: 7.4 | Incubation: 30Β°C, Assay: 30Β°C | 25 Β΅M Methyl red | N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid | 250 Β΅M NADH, 5 Β΅M FMN | Incubation: 80 rpm | Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase | Isooctane | 10 % v/v | 100.0 | 69.03 | % | Direct | Continuous | Incubation: ?, Assay: 25 mM Tris-HCl buffer | Incubation: ?, Assay: 7.4 | Incubation: 30Β°C, Assay: 30Β°C | 25 Β΅M Methyl red | N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid | 250 Β΅M NADH, 5 Β΅M FMN | Incubation: 80 rpm | Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase | n-Hexane | 10 % v/v | 100.0 | 103.73 | % | Direct | Continuous | Incubation: ?, Assay: 25 mM Tris-HCl buffer | Incubation: ?, Assay: 7.4 | Incubation: 30Β°C, Assay: 30Β°C | 25 Β΅M Methyl red | N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid | 250 Β΅M NADH, 5 Β΅M FMN | Incubation: 80 rpm | Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase | Chloroform | 10 % v/v | 100.0 | 10.82 | % | Direct | Continuous | Incubation: ?, Assay: 25 mM Tris-HCl buffer | Incubation: ?, Assay: 7.4 | Incubation: 30Β°C, Assay: 30Β°C | 25 Β΅M Methyl red | N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid | 250 Β΅M NADH, 5 Β΅M FMN | Incubation: 80 rpm | Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase | Isoamyl Alcohol | 10 % v/v | 100.0 | 13.06 | % | Direct | Continuous | Incubation: ?, Assay: 25 mM Tris-HCl buffer | Incubation: ?, Assay: 7.4 | Incubation: 30Β°C, Assay: 30Β°C | 25 Β΅M Methyl red | N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid | 250 Β΅M NADH, 5 Β΅M FMN | Incubation: 80 rpm | Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase | 1-Butanol | 10 % v/v | 100.0 | 13.06 | % | Direct | Continuous | Incubation: ?, Assay: 25 mM Tris-HCl buffer | Incubation: ?, Assay: 7.4 | Incubation: 30Β°C, Assay: 30Β°C | 25 Β΅M Methyl red | N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid | 250 Β΅M NADH, 5 Β΅M FMN | Incubation: 80 rpm | Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase | 1-Propanol | 10 % v/v | 100.0 | 84.05 | % | Direct | Continuous | Incubation: ?, Assay: 25 mM Tris-HCl buffer | Incubation: ?, Assay: 7.4 | Incubation: 30Β°C, Assay: 30Β°C | 25 Β΅M Methyl red | N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid | 250 Β΅M NADH, 5 Β΅M FMN | Incubation: 80 rpm | Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase | Isopropanol | 10 % v/v | 100.0 | 87.73 | % | Direct | Continuous | Incubation: ?, Assay: 25 mM Tris-HCl buffer | Incubation: ?, Assay: 7.4 | Incubation: 30Β°C, Assay: 30Β°C | 25 Β΅M Methyl red | N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid | 250 Β΅M NADH, 5 Β΅M FMN | Incubation: 80 rpm | Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents |
| Stability - Incubation | Activity after incubation (1 hour at 30Β°C), measured by absorbance spectrophotometry (decrease in methyl red absorbance measurement, 430 nm) in aqueous phase | Acetonitrile | 10 % v/v | 100.0 | 48.47 | % | Direct | Continuous | Incubation: ?, Assay: 25 mM Tris-HCl buffer | Incubation: ?, Assay: 7.4 | Incubation: 30Β°C, Assay: 30Β°C | 25 Β΅M Methyl red | N,N-dimethyl-p-phenylenediamine , p-aminobenzoic acid | 250 Β΅M NADH, 5 Β΅M FMN | Incubation: 80 rpm | Non-incubated control (in %), assay in aqueous phase | Clear assay in aqueous phase, still 5% organic solvent in assay solution for hydrophilic solvents |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.