Lipase (gene GPL) from Aeribacillus pallidus

Enzyme Description

Species
Aeribacillus pallidus β†—
Extremophile
Yes "thermophilic" organism
EC Number
3.1.1.3 β†—

Sequence

Length: 236 amino acids
MAVESRRPSVIRPGLFSVEAAADRRRREFDHHNEAILHKQVPIDVVFFGDSITHWWDVSTYFGRSGRVVVNRGIGGDTSEYARRRFAADVLQLKPKYAVILIGVNNTWALDAWHPEERRTAEQICEEVVADVESMLKAAQEHGIVPILCSILPTRIDRYARNEERNRLIVRINGGLKDLAERLNVIYVDYHTALADADGVTLREGLADDGLHPHVLGYDIMAAVLRETLAGHGIDL
Ameni Ktata et al. (2019) β€” Purification, biochemical and molecular study of lipase producing from a newly thermoalkaliphilic Aeribacillus pallidus for oily wastewater treatment
The Journal of Biochemistry  Β· doi:10.1093/jb/mvz083 β†—  Β· Stability - Incubation
36 measurements ▼
Database ID
UniProt: A0A9X3Z4J0 β†—
Sequence Annotation
Explicit - Provided
Protein Source
Purified, bacterium Aeribacillus pallidus

Experimental Data (36 measurements)

36 measurements β€” page 1 of 2
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (2 hours at 37Β°C), measured by titration with pH-stat in aqueous phase Methanol 50 % v/v 100 92 % Direct Continuous ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 65Β°C 0.83% volume Tributyrin glycerol , tributyric acid β€” Yes, "with shaking" Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at 37Β°C), measured by titration with pH-stat in aqueous phase Isopropanol 50 % v/v 100 59 % Direct Continuous ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 65Β°C 0.83% volume Tributyrin glycerol , tributyric acid β€” Yes, "with shaking" Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at 37Β°C), measured by titration with pH-stat in aqueous phase Isooctane 10 % v/v 100 16 % Direct Continuous ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 65Β°C 0.83% volume Tributyrin glycerol , tributyric acid β€” Yes, "with shaking" Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at 37Β°C), measured by titration with pH-stat in aqueous phase Isooctane 50 % v/v 100 0 % Direct Continuous ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 65Β°C 0.83% volume Tributyrin glycerol , tributyric acid β€” Yes, "with shaking" Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at 37Β°C), measured by titration with pH-stat in aqueous phase Dimethyl Sulfoxide (DMSO) 10 % v/v 100 100 % Direct Continuous ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 65Β°C 0.83% volume Tributyrin glycerol , tributyric acid β€” Yes, "with shaking" Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at 37Β°C), measured by titration with pH-stat in aqueous phase Dimethyl Sulfoxide (DMSO) 50 % v/v 100 98 % Direct Continuous ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 65Β°C 0.83% volume Tributyrin glycerol , tributyric acid β€” Yes, "with shaking" Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at 37Β°C), measured by titration with pH-stat in aqueous phase n-Hexane 10 % v/v 100 0 % Direct Continuous ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 65Β°C 0.83% volume Tributyrin glycerol , tributyric acid β€” Yes, "with shaking" Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at 37Β°C), measured by titration with pH-stat in aqueous phase n-Hexane 50 % v/v 100 0 % Direct Continuous ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 65Β°C 0.83% volume Tributyrin glycerol , tributyric acid β€” Yes, "with shaking" Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at 37Β°C), measured by titration with pH-stat in aqueous phase Methanol 10 % v/v 100 134 % Direct Continuous ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 65Β°C 0.83% volume Tributyrin glycerol , tributyric acid β€” Yes, "with shaking" Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at 37Β°C), measured by titration with pH-stat in aqueous phase Isopropanol 10 % v/v 100 125 % Direct Continuous ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 65Β°C 0.83% volume Tributyrin glycerol , tributyric acid β€” Yes, "with shaking" Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at 37Β°C), measured by titration with pH-stat in aqueous phase Chloroform 10 % v/v 100 0 % Direct Continuous ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 65Β°C 0.83% volume Tributyrin glycerol , tributyric acid β€” Yes, "with shaking" Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at 37Β°C), measured by titration with pH-stat in aqueous phase Chloroform 50 % v/v 100 0 % Direct Continuous ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 65Β°C 0.83% volume Tributyrin glycerol , tributyric acid β€” Yes, "with shaking" Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at 37Β°C), measured by titration with pH-stat in aqueous phase Acetone 10 % v/v 100 48 % Direct Continuous ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 65Β°C 0.83% volume Tributyrin glycerol , tributyric acid β€” Yes, "with shaking" Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at 37Β°C), measured by titration with pH-stat in aqueous phase Acetone 50 % v/v 100 29 % Direct Continuous ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 65Β°C 0.83% volume Tributyrin glycerol , tributyric acid β€” Yes, "with shaking" Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at 37Β°C), measured by titration with pH-stat in aqueous phase Ethanol 10 % v/v 100 125 % Direct Continuous ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 65Β°C 0.83% volume Tributyrin glycerol , tributyric acid β€” Yes, "with shaking" Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at 37Β°C), measured by titration with pH-stat in aqueous phase Ethanol 50 % v/v 100 75 % Direct Continuous ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 65Β°C 0.83% volume Tributyrin glycerol , tributyric acid β€” Yes, "with shaking" Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at 37Β°C), measured by titration with pH-stat in aqueous phase Acetonitrile 10 % v/v 100 134 % Direct Continuous ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 65Β°C 0.83% volume Tributyrin glycerol , tributyric acid β€” Yes, "with shaking" Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (2 hours at 37Β°C), measured by titration with pH-stat in aqueous phase Acetonitrile 50 % v/v 100 125 % Direct Continuous ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 65Β°C 0.83% volume Tributyrin glycerol , tributyric acid β€” Yes, "with shaking" Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 37Β°C), measured by titration with pH-stat in aqueous phase Methanol 50 % v/v 100 96 % Direct Continuous ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 65Β°C 0.83% volume Tributyrin glycerol , tributyric acid β€” Yes, "with shaking" Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
Stability - Incubation Activity after incubation (1 hour at 37Β°C), measured by titration with pH-stat in aqueous phase Isopropanol 50 % v/v 100 84 % Direct Continuous ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate Incubation: ?, Assay: 10 Incubation: 37Β°C, Assay: 65Β°C 0.83% volume Tributyrin glycerol , tributyric acid β€” Yes, "with shaking" Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent
β€Ή Prev
1 2
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*