Lipase (gene GPL) from Aeribacillus pallidus
Enzyme Description
Sequence
MAVESRRPSVIRPGLFSVEAAADRRRREFDHHNEAILHKQVPIDVVFFGDSITHWWDVSTYFGRSGRVVVNRGIGGDTSEYARRRFAADVLQLKPKYAVILIGVNNTWALDAWHPEERRTAEQICEEVVADVESMLKAAQEHGIVPILCSILPTRIDRYARNEERNRLIVRINGGLKDLAERLNVIYVDYHTALADADGVTLREGLADDGLHPHVLGYDIMAAVLRETLAGHGIDL
Ameni Ktata et al. (2019)
β Purification, biochemical and molecular study of lipase producing from a newly thermoalkaliphilic Aeribacillus pallidus for oily wastewater treatment
The Journal of Biochemistry
Β· doi:10.1093/jb/mvz083 β
Β· Stability - Incubation
▼
Database ID
UniProt: A0A9X3Z4J0 β
Sequence Annotation
Explicit - Provided
Protein Source
Purified, bacterium Aeribacillus pallidus
Experimental Data (36 measurements)
36 measurements β page 2 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by titration with pH-stat in aqueous phase | Isooctane | 10 % v/v | 100 | 21 | % | Direct | Continuous | ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 65Β°C | 0.83% volume Tributyrin | glycerol , tributyric acid | β | Yes, "with shaking" | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by titration with pH-stat in aqueous phase | Isooctane | 50 % v/v | 100 | 0 | % | Direct | Continuous | ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 65Β°C | 0.83% volume Tributyrin | glycerol , tributyric acid | β | Yes, "with shaking" | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by titration with pH-stat in aqueous phase | Dimethyl Sulfoxide (DMSO) | 10 % v/v | 100 | 100 | % | Direct | Continuous | ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 65Β°C | 0.83% volume Tributyrin | glycerol , tributyric acid | β | Yes, "with shaking" | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by titration with pH-stat in aqueous phase | Dimethyl Sulfoxide (DMSO) | 50 % v/v | 100 | 100 | % | Direct | Continuous | ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 65Β°C | 0.83% volume Tributyrin | glycerol , tributyric acid | β | Yes, "with shaking" | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by titration with pH-stat in aqueous phase | n-Hexane | 10 % v/v | 100 | 21 | % | Direct | Continuous | ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 65Β°C | 0.83% volume Tributyrin | glycerol , tributyric acid | β | Yes, "with shaking" | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by titration with pH-stat in aqueous phase | n-Hexane | 50 % v/v | 100 | 0 | % | Direct | Continuous | ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 65Β°C | 0.83% volume Tributyrin | glycerol , tributyric acid | β | Yes, "with shaking" | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by titration with pH-stat in aqueous phase | Methanol | 10 % v/v | 100 | 134 | % | Direct | Continuous | ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 65Β°C | 0.83% volume Tributyrin | glycerol , tributyric acid | β | Yes, "with shaking" | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by titration with pH-stat in aqueous phase | Isopropanol | 10 % v/v | 100 | 134 | % | Direct | Continuous | ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 65Β°C | 0.83% volume Tributyrin | glycerol , tributyric acid | β | Yes, "with shaking" | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by titration with pH-stat in aqueous phase | Chloroform | 10 % v/v | 100 | 10 | % | Direct | Continuous | ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 65Β°C | 0.83% volume Tributyrin | glycerol , tributyric acid | β | Yes, "with shaking" | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by titration with pH-stat in aqueous phase | Chloroform | 50 % v/v | 100 | 0 | % | Direct | Continuous | ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 65Β°C | 0.83% volume Tributyrin | glycerol , tributyric acid | β | Yes, "with shaking" | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by titration with pH-stat in aqueous phase | Acetone | 10 % v/v | 100 | 50 | % | Direct | Continuous | ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 65Β°C | 0.83% volume Tributyrin | glycerol , tributyric acid | β | Yes, "with shaking" | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by titration with pH-stat in aqueous phase | Acetone | 50 % v/v | 100 | 30 | % | Direct | Continuous | ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 65Β°C | 0.83% volume Tributyrin | glycerol , tributyric acid | β | Yes, "with shaking" | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by titration with pH-stat in aqueous phase | Ethanol | 10 % v/v | 100 | 125 | % | Direct | Continuous | ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 65Β°C | 0.83% volume Tributyrin | glycerol , tributyric acid | β | Yes, "with shaking" | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by titration with pH-stat in aqueous phase | Ethanol | 50 % v/v | 100 | 75 | % | Direct | Continuous | ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 65Β°C | 0.83% volume Tributyrin | glycerol , tributyric acid | β | Yes, "with shaking" | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by titration with pH-stat in aqueous phase | Acetonitrile | 10 % v/v | 100 | 134 | % | Direct | Continuous | ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 65Β°C | 0.83% volume Tributyrin | glycerol , tributyric acid | β | Yes, "with shaking" | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
| Stability - Incubation | Activity after incubation (1 hour at 37Β°C), measured by titration with pH-stat in aqueous phase | Acetonitrile | 50 % v/v | 100 | 125 | % | Direct | Continuous | ? Incubation, 2.5 mM Tris-HCl buffer, 150 mM NaCl, 1 mM CaCl2, 1 mM sodium taurodeoxycholate | Incubation: ?, Assay: 10 | Incubation: 37Β°C, Assay: 65Β°C | 0.83% volume Tributyrin | glycerol , tributyric acid | β | Yes, "with shaking" | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether the assay was in aqueous phase or in the presence of organic solvent |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.