Serine protease (gene SpSKF4) from Geobacillus thermoglucosidasius SKF4
Enzyme Description
Extremophile
Yes
"thermophilic" organism
EC Number
Sequence
MKFKAIVSLSLAVSMSFFPFLVEAASNDGVESPKTVSEINVSHEKGAYVQGEVIVQFKEQVNAEEKAKALKEVGATAVPDNDRVKSKFNVLKVGNVEAVVKALNNNPLVEYAEPNYLFNAAWTPNDTYYQGYQYGPQNTYTDYAWDVTKGSSGQEIAVIDTGVDYTHPDLDGKVIKGYDFVDNDYDPMDLNNHGTHVAGIAAAETNNATGIAGMAPNTRILAVRALDRNGSGTLSDIADAIIYAADSGAEVINLSLGCDCHTTTLENAVNYAWNKGSVVVAAAGNNGSSTTFEPASYENVIAVGAVDQYDRLASFSNYGTWVDVVAPGVDIVSTITGNRYAYMSGTSMASPHVAGLAALLASQGRNNIEIRQAIEQTADKISGTGTYFKYGRINSYNAVTY
Suleiman D Allison et al. (2023)
β Molecular Cloning, Characterization, and Application of Organic Solvent-Stable and Detergent-Compatible Thermostable Alkaline Protease from Geobacillus thermoglucosidasius SKF4
Journal of Microbiology and Biotechnology
Β· doi:10.4014/jmb.2306.06050 β
Β· Stability - Incubation
▼
Database ID
UniProt: A0A8F2ZC80 β
Sequence Annotation
Explicit - Provided
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)
Experimental Data (21 measurements)
21 measurements β page 1 of 2
| Property | Assay | Solvent | Solvent Volume | Aqueous Reference | Measured Value | Units | Extraction method | Data type | Solution | pH | Temperature | Substrate(s) | Product(s) | Cofactor(s) | Shaking | Comments |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Stability - Incubation | Activity after incubation (40 minutes at 80Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase | 1-Butanol | 30 % v/v | 100.0 | 85.5 | % | Digital | Continuous | Incubation: ?, Assay: Glycine-NaOH buffer | Incubation: ?, Assay: 10 | Incubation: 80Β°C, Assay: 60Β°C | 0.007 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (40 minutes at 80Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase | n-Hexane | 50 % v/v | 100.0 | 50.4 | % | Digital | Continuous | Incubation: ?, Assay: Glycine-NaOH buffer | Incubation: ?, Assay: 10 | Incubation: 80Β°C, Assay: 60Β°C | 0.007 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (40 minutes at 80Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase | Chloroform | 50 % v/v | 100.0 | 68.0 | % | Digital | Continuous | Incubation: ?, Assay: Glycine-NaOH buffer | Incubation: ?, Assay: 10 | Incubation: 80Β°C, Assay: 60Β°C | 0.007 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (40 minutes at 80Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase | Isopropanol | 50 % v/v | 100.0 | 61.2 | % | Digital | Continuous | Incubation: ?, Assay: Glycine-NaOH buffer | Incubation: ?, Assay: 10 | Incubation: 80Β°C, Assay: 60Β°C | 0.007 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (40 minutes at 80Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase | 1-Butanol | 50 % v/v | 100.0 | 66.9 | % | Digital | Continuous | Incubation: ?, Assay: Glycine-NaOH buffer | Incubation: ?, Assay: 10 | Incubation: 80Β°C, Assay: 60Β°C | 0.007 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (40 minutes at 80Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase | Methanol | 50 % v/v | 100.0 | 81.0 | % | Digital | Continuous | Incubation: ?, Assay: Glycine-NaOH buffer | Incubation: ?, Assay: 10 | Incubation: 80Β°C, Assay: 60Β°C | 0.007 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (40 minutes at 80Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase | Acetone | 50 % v/v | 100.0 | 71.8 | % | Digital | Continuous | Incubation: ?, Assay: Glycine-NaOH buffer | Incubation: ?, Assay: 10 | Incubation: 80Β°C, Assay: 60Β°C | 0.007 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (40 minutes at 80Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase | Ethanol | 50 % v/v | 100.0 | 102.7 | % | Digital | Continuous | Incubation: ?, Assay: Glycine-NaOH buffer | Incubation: ?, Assay: 10 | Incubation: 80Β°C, Assay: 60Β°C | 0.007 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (40 minutes at 80Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase | n-Hexane | 30 % v/v | 100.0 | 55.5 | % | Digital | Continuous | Incubation: ?, Assay: Glycine-NaOH buffer | Incubation: ?, Assay: 10 | Incubation: 80Β°C, Assay: 60Β°C | 0.007 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (40 minutes at 80Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase | Chloroform | 30 % v/v | 100.0 | 89.4 | % | Digital | Continuous | Incubation: ?, Assay: Glycine-NaOH buffer | Incubation: ?, Assay: 10 | Incubation: 80Β°C, Assay: 60Β°C | 0.007 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (40 minutes at 80Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase | Isopropanol | 30 % v/v | 100.0 | 90.6 | % | Digital | Continuous | Incubation: ?, Assay: Glycine-NaOH buffer | Incubation: ?, Assay: 10 | Incubation: 80Β°C, Assay: 60Β°C | 0.007 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (40 minutes at 80Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase | Ethanol | 10 % v/v | 100.0 | 93.9 | % | Digital | Continuous | Incubation: ?, Assay: Glycine-NaOH buffer | Incubation: ?, Assay: 10 | Incubation: 80Β°C, Assay: 60Β°C | 0.007 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (40 minutes at 80Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase | Methanol | 30 % v/v | 100.0 | 112.9 | % | Digital | Continuous | Incubation: ?, Assay: Glycine-NaOH buffer | Incubation: ?, Assay: 10 | Incubation: 80Β°C, Assay: 60Β°C | 0.007 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (40 minutes at 80Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase | Acetone | 30 % v/v | 100.0 | 87.4 | % | Digital | Continuous | Incubation: ?, Assay: Glycine-NaOH buffer | Incubation: ?, Assay: 10 | Incubation: 80Β°C, Assay: 60Β°C | 0.007 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (40 minutes at 80Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase | Ethanol | 30 % v/v | 100.0 | 104.1 | % | Digital | Continuous | Incubation: ?, Assay: Glycine-NaOH buffer | Incubation: ?, Assay: 10 | Incubation: 80Β°C, Assay: 60Β°C | 0.007 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (40 minutes at 80Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase | n-Hexane | 10 % v/v | 100.0 | 60.6 | % | Digital | Continuous | Incubation: ?, Assay: Glycine-NaOH buffer | Incubation: ?, Assay: 10 | Incubation: 80Β°C, Assay: 60Β°C | 0.007 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (40 minutes at 80Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase | Chloroform | 10 % v/v | 100.0 | 98.0 | % | Digital | Continuous | Incubation: ?, Assay: Glycine-NaOH buffer | Incubation: ?, Assay: 10 | Incubation: 80Β°C, Assay: 60Β°C | 0.007 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (40 minutes at 80Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase | Isopropanol | 10 % v/v | 100.0 | 96.7 | % | Digital | Continuous | Incubation: ?, Assay: Glycine-NaOH buffer | Incubation: ?, Assay: 10 | Incubation: 80Β°C, Assay: 60Β°C | 0.007 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (40 minutes at 80Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase | 1-Butanol | 10 % v/v | 100.0 | 88.8 | % | Digital | Continuous | Incubation: ?, Assay: Glycine-NaOH buffer | Incubation: ?, Assay: 10 | Incubation: 80Β°C, Assay: 60Β°C | 0.007 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control |
| Stability - Incubation | Activity after incubation (40 minutes at 80Β°C), measured by absorbance spectrophotometry (colorimetric assay, Folin-Ciocalteu phenol reagant and free tyrosines reaction products absorbance measurement, 700 nm) in aqueous phase | Methanol | 10 % v/v | 100.0 | 70.0 | % | Digital | Continuous | Incubation: ?, Assay: Glycine-NaOH buffer | Incubation: ?, Assay: 10 | Incubation: 80Β°C, Assay: 60Β°C | 0.007 Casein | free amino acids , Peptides | β | β | Non-incubated control (in %), assay in aqueous phase | High uncertainty about whether assay really was in the presence of organic solvent or in aqueous phase, uncertainty about control |
Visualization : Stability β Incubation
One bar per measurement. Colour = solvent, shade = solvent volume.