Halohydrin dehalogenase (gene HHDH) from Agrobacterium radiobacter AD1

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 254 amino acids
MSTAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERWPGMPE
Nevena MilčiΔ‡ et al. (2022) β€” Inhibitory Effect of DMSO on Halohydrin Dehalogenase: Experimental and Computational Insights into the Influence of an Organic Co-solvent on the Structural and Catalytic Properties of a Biocatalyst
Chemistry–A European Journal  Β· doi:10.1002/chem.202201923 β†—  Β· Activity - Classical Stability - deltaHTm Stability - Inactivation Rate Constant Stability - Incubation Stability - Tm Stability - Half-life
73 measurements
Database ID
UniProt: Q93D82 β†—
Sequence Annotation
Explicit - Provided PDB Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli MC1061

Experimental Data (73 measurements)

73 measurements β€” page 1 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 35 % v/v 4.7 0.5 U/mg Digital Continuous 100 mM Tris-SO4 buffer 7.5 25Β°C 2 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5 % v/v 5.2 2.9 U/mg Digital Continuous 100 mM Tris-SO4 buffer 7.5 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) with 1% organic solvent | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20 % v/v 5.2 1.1 U/mg Digital Continuous 100 mM Tris-SO4 buffer 7.5 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) with 1% organic solvent | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 35 % v/v 5.2 0.7 U/mg Digital Continuous 100 mM Tris-SO4 buffer 7.5 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) with 1% organic solvent | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50 % v/v 5.2 0.4 U/mg Digital Continuous 100 mM Tris-SO4 buffer 7.5 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) with 1% organic solvent | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethylformamide (DMF) 20 % v/v 100.0 73.0 % Direct Continuous 100 mM Tris-SO4 buffer 7.5 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in %) | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethylformamide (DMF) 35 % v/v 100.0 22.0 % Direct Continuous 100 mM Tris-SO4 buffer 7.5 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in %) | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethylformamide (DMF) 50 % v/v 100.0 4.0 % Direct Continuous 100 mM Tris-SO4 buffer 7.5 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in %) | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50 % v/v 4.7 0.3 U/mg Digital Continuous 100 mM Tris-SO4 buffer 7.5 25Β°C 2 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10 % v/v 5.2 1.9 U/mg Digital Continuous 100 mM Tris-SO4 buffer 7.5 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) with 1% organic solvent | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20 % v/v 4.7 0.8 U/mg Digital Continuous 100 mM Tris-SO4 buffer 7.5 25Β°C 2 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10 % v/v 4.7 1.4 U/mg Digital Continuous 100 mM Tris-SO4 buffer 7.5 25Β°C 2 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5 % v/v 4.7 2.5 U/mg Digital Continuous 100 mM Tris-SO4 buffer 7.5 25Β°C 2 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50 % v/v 4.2 0.3 U/mg Digital Continuous 100 mM Tris-SO4 buffer 7.5 25Β°C 1 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 35 % v/v 4.2 0.4 U/mg Digital Continuous 100 mM Tris-SO4 buffer 7.5 25Β°C 1 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20 % v/v 4.2 0.5 U/mg Digital Continuous 100 mM Tris-SO4 buffer 7.5 25Β°C 1 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10 % v/v 4.2 1.0 U/mg Digital Continuous 100 mM Tris-SO4 buffer 7.5 25Β°C 1 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5 % v/v 4.2 1.9 U/mg Digital Continuous 100 mM Tris-SO4 buffer 7.5 25Β°C 1 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50 % v/v 5.2 0.4 U/mg Digital Continuous 100 mM Tris-SO4 buffer 7.5 25Β°C 4 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) | Enzyme cell-free extracts used for measurements
Activity - Classical Activity measured by HPLC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 35 % v/v 5.2 0.7 U/mg Digital Continuous 100 mM Tris-SO4 buffer 7.5 25Β°C 4 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” 1000 rpm Classical aqueous control (in U/mg) | Enzyme cell-free extracts used for measurements
β€Ή Prev
1 2 3 4

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Tm

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Ξ”HTm

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Half-life

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Inactivation Rate Constant

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*