Halohydrin dehalogenase (gene HHDH) from Agrobacterium radiobacter AD1

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 254 amino acids
MSTAIVTNVKHFGGMGSALRLSEAGHTVACHDESFKQKDELEAFAETYPQLKPMSEQEPAELIEAVTSAYGQVDVLVSNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYPTEPWKTNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPMIERWPGMPE
Nevena MilčiΔ‡ et al. (2022) β€” Inhibitory Effect of DMSO on Halohydrin Dehalogenase: Experimental and Computational Insights into the Influence of an Organic Co-solvent on the Structural and Catalytic Properties of a Biocatalyst
Chemistry–A European Journal  Β· doi:10.1002/chem.202201923 β†—  Β· Activity - Classical Stability - deltaHTm Stability - Inactivation Rate Constant Stability - Incubation Stability - Tm Stability - Half-life
73 measurements
Database ID
UniProt: Q93D82 β†—
Sequence Annotation
Explicit - Provided PDB Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli MC1061

Experimental Data (73 measurements)

73 measurements β€” page 4 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (76 hours at 50Β°C), measured by HPLC in aqueous phase Dimethyl Sulfoxide (DMSO) 40 % v/v 100.0 24.0 % Digital Continuous Incubation: 100 mM Tris-SO4 buffer, Assay: 100 mM Tris-SO4 buffer Incubation: 7.5, Assay: 7.5 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” Incubation: 1000 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase/Enzyme cell-free extracts used for measurements
Stability - Incubation Activity after incubation (0.1 hour at 50Β°C),measured by HPLC in aqueous phase Dimethyl Sulfoxide (DMSO) 50 % v/v 100.0 65.0 % Digital Continuous Incubation: 100 mM Tris-SO4 buffer, Assay: 100 mM Tris-SO4 buffer Incubation: 7.5, Assay: 7.5 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” Incubation: 1000 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase/Enzyme cell-free extracts used for measurements
Stability - Incubation Activity after incubation (1 hour at 50Β°C), measured by HPLC in aqueous phase Dimethyl Sulfoxide (DMSO) 50 % v/v 100.0 29.0 % Digital Continuous Incubation: 100 mM Tris-SO4 buffer, Assay: 100 mM Tris-SO4 buffer Incubation: 7.5, Assay: 7.5 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” Incubation: 1000 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase/Enzyme cell-free extracts used for measurements
Stability - Incubation Activity after incubation (2.5 hours at 50Β°C), measured by HPLC in aqueous phase Dimethyl Sulfoxide (DMSO) 50 % v/v 100.0 18.0 % Digital Continuous Incubation: 100 mM Tris-SO4 buffer, Assay: 100 mM Tris-SO4 buffer Incubation: 7.5, Assay: 7.5 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” Incubation: 1000 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase/Enzyme cell-free extracts used for measurements
Stability - Incubation Activity after incubation (4 hours at 50Β°C), measured by HPLC in aqueous phase Dimethyl Sulfoxide (DMSO) 50 % v/v 100.0 12.0 % Digital Continuous Incubation: 100 mM Tris-SO4 buffer, Assay: 100 mM Tris-SO4 buffer Incubation: 7.5, Assay: 7.5 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” Incubation: 1000 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase/Enzyme cell-free extracts used for measurements
Stability - Incubation Activity after incubation (29 hours at 50Β°C), measured by HPLC in aqueous phase Dimethyl Sulfoxide (DMSO) 50 % v/v 100.0 2.0 % Digital Continuous Incubation: 100 mM Tris-SO4 buffer, Assay: 100 mM Tris-SO4 buffer Incubation: 7.5, Assay: 7.5 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” Incubation: 1000 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase/Enzyme cell-free extracts used for measurements
Stability - Incubation Activity after incubation (72 hours at 50Β°C), measured by HPLC in aqueous phase Dimethyl Sulfoxide (DMSO) 50 % v/v 100.0 1.0 % Digital Continuous Incubation: 100 mM Tris-SO4 buffer, Assay: 100 mM Tris-SO4 buffer Incubation: 7.5, Assay: 7.5 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” Incubation: 1000 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase/Enzyme cell-free extracts used for measurements
Stability - Incubation Activity after incubation (4 hours at 50Β°C),measured by HPLC in aqueous phase Dimethyl Sulfoxide (DMSO) 30 % v/v 100.0 94.0 % Digital Continuous Incubation: 100 mM Tris-SO4 buffer, Assay: 100 mM Tris-SO4 buffer Incubation: 7.5, Assay: 7.5 Incubation: 25Β°C, Assay: 25Β°C 5 mM p-Nitro-2-bromo-1-phenylethanol para-nitro styrene oxide β€” Incubation: 1000 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase/Enzyme cell-free extracts used for measurements
Stability - Tm Tm measured by DSC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50 % v/v 60.0 37.7 Β°C Direct Continuous 100 mM Tris-SO4 buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C) | Enzyme cell-free extracts used for measurements
Stability - Tm Tm measured by DSC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 40 % v/v 60.0 43.2 Β°C Direct Continuous 100 mM Tris-SO4 buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C) | Enzyme cell-free extracts used for measurements
Stability - Tm Tm measured by DSC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30 % v/v 60.0 46.9 Β°C Direct Continuous 100 mM Tris-SO4 buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C) | Enzyme cell-free extracts used for measurements
Stability - Tm Tm measured by DSC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20 % v/v 60.0 54.1 Β°C Direct Continuous 100 mM Tris-SO4 buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C) | Enzyme cell-free extracts used for measurements
Stability - Tm Tm measured by DSC in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5 % v/v 60.0 58.6 Β°C Direct Continuous 100 mM Tris-SO4 buffer 7.5 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C) | Enzyme cell-free extracts used for measurements
1 2 3 4
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Tm

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Ξ”HTm

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Half-life

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Inactivation Rate Constant

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*