Ene-reductase OYE1 from Saccharomyces pastorianus

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 400 amino acids
MSFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Frieda A. Sorgenfrei et al. (2024) β€” Solvent concentration at 50% protein unfolding may reform enzyme stability ranking and process window identification
Nature Communications  Β· doi:10.1038/s41467-024-49774-0 β†—  Β· Activity - Classical Stability - Tm
150 measurements
Database ID
UniProt: Q02899 β†—
Sequence Annotation
Explicit - Provided UniProt Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (150 measurements)

150 measurements β€” page 4 of 8
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 20 % v/v 100.0 6.1 % Direct Continuous 50 mM sodium phosphate 7.4 40Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 25 % v/v 100.0 3.0 % Direct Continuous 50 mM sodium phosphate 7.4 40Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 30 % v/v 100.0 3.0 % Direct Continuous 50 mM sodium phosphate 7.4 40Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 35 % v/v 100.0 3.0 % Direct Continuous 50 mM sodium phosphate 7.4 40Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 40 % v/v 100.0 3.0 % Direct Continuous 50 mM sodium phosphate 7.4 40Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 45 % v/v 100.0 3.0 % Direct Continuous 50 mM sodium phosphate 7.4 40Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 5 % v/v 100.0 170.0 % Direct Continuous 50 mM sodium phosphate 7.4 45Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 10 % v/v 100.0 120.0 % Direct Continuous 50 mM sodium phosphate 7.4 45Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 15 % v/v 100.0 50.0 % Direct Continuous 50 mM sodium phosphate 7.4 45Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 20 % v/v 100.0 20.0 % Direct Continuous 50 mM sodium phosphate 7.4 45Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 25 % v/v 100.0 10.0 % Direct Continuous 50 mM sodium phosphate 7.4 45Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 30 % v/v 100.0 20.0 % Direct Continuous 50 mM sodium phosphate 7.4 45Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 35 % v/v 100.0 30.0 % Direct Continuous 50 mM sodium phosphate 7.4 45Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 40 % v/v 100.0 10.0 % Direct Continuous 50 mM sodium phosphate 7.4 45Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 45 % v/v 100.0 20.0 % Direct Continuous 50 mM sodium phosphate 7.4 45Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 5 % v/v 100.0 87.5 % Direct Continuous 50 mM sodium phosphate 7.4 25Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 10 % v/v 100.0 125.0 % Direct Continuous 50 mM sodium phosphate 7.4 25Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 15 % v/v 100.0 137.5 % Direct Continuous 50 mM sodium phosphate 7.4 25Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 20 % v/v 100.0 154.2 % Direct Continuous 50 mM sodium phosphate 7.4 25Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 25 % v/v 100.0 129.2 % Direct Continuous 50 mM sodium phosphate 7.4 25Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
1 … 3 4 5 … 8

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Tm

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*