Ene-reductase OYE1 from Saccharomyces pastorianus

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 400 amino acids
MSFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Frieda A. Sorgenfrei et al. (2024) β€” Solvent concentration at 50% protein unfolding may reform enzyme stability ranking and process window identification
Nature Communications  Β· doi:10.1038/s41467-024-49774-0 β†—  Β· Activity - Classical Stability - Tm
150 measurements
Database ID
UniProt: Q02899 β†—
Sequence Annotation
Explicit - Provided UniProt Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (150 measurements)

150 measurements β€” page 5 of 8
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 30 % v/v 100.0 79.2 % Direct Continuous 50 mM sodium phosphate 7.4 25Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 35 % v/v 100.0 12.5 % Direct Continuous 50 mM sodium phosphate 7.4 25Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 40 % v/v 100.0 8.3 % Direct Continuous 50 mM sodium phosphate 7.4 25Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 45 % v/v 100.0 4.2 % Direct Continuous 50 mM sodium phosphate 7.4 25Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 5 % v/v 100.0 138.1 % Direct Continuous 50 mM sodium phosphate 7.4 30Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 10 % v/v 100.0 171.4 % Direct Continuous 50 mM sodium phosphate 7.4 30Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 15 % v/v 100.0 190.5 % Direct Continuous 50 mM sodium phosphate 7.4 30Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 20 % v/v 100.0 204.8 % Direct Continuous 50 mM sodium phosphate 7.4 30Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 25 % v/v 100.0 142.9 % Direct Continuous 50 mM sodium phosphate 7.4 30Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 30 % v/v 100.0 66.7 % Direct Continuous 50 mM sodium phosphate 7.4 30Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 35 % v/v 100.0 19.0 % Direct Continuous 50 mM sodium phosphate 7.4 30Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 40 % v/v 100.0 14.3 % Direct Continuous 50 mM sodium phosphate 7.4 30Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 45 % v/v 100.0 14.3 % Direct Continuous 50 mM sodium phosphate 7.4 30Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 5 % v/v 100.0 124.3 % Direct Continuous 50 mM sodium phosphate 7.4 35Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 10 % v/v 100.0 140.5 % Direct Continuous 50 mM sodium phosphate 7.4 35Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 15 % v/v 100.0 148.6 % Direct Continuous 50 mM sodium phosphate 7.4 35Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 20 % v/v 100.0 108.1 % Direct Continuous 50 mM sodium phosphate 7.4 35Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 25 % v/v 100.0 16.2 % Direct Continuous 50 mM sodium phosphate 7.4 35Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 30 % v/v 100.0 2.7 % Direct Continuous 50 mM sodium phosphate 7.4 35Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
Activity - Classical Activity measured by absorbance spectrophotometry (NAD(P)H absorbance measurement, 340 nm) in the presence of organic solvent Methanol 35 % v/v 100.0 2.7 % Direct Continuous 50 mM sodium phosphate 7.4 35Β°C 10 mM Cyclohex-2-enone Cyclohexane 0.2 mM NAD(P)H β€” Classical aqueous control (in %) | Raw activity data of reaction temperature screening
1 … 4 5 6 … 8

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Tm

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*