Ene-reductase OYE1 from Saccharomyces pastorianus

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 400 amino acids
MSFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRALHPGNIPNRDWAVEYYTQRAQRPGTMIITEGAFISPQAGGYDNAPGVWSEEQMVEWTKIFNAIHEKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKANNPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTLEVVDALVEAIGHEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELEKRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYEGGSNDFVYSIWKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYQMSAHGYIDYPTYEEALKLGWDKK
Frieda A. Sorgenfrei et al. (2024) β€” Solvent concentration at 50% protein unfolding may reform enzyme stability ranking and process window identification
Nature Communications  Β· doi:10.1038/s41467-024-49774-0 β†—  Β· Activity - Classical Stability - Tm
150 measurements
Database ID
UniProt: Q02899 β†—
Sequence Annotation
Explicit - Provided UniProt Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (150 measurements)

150 measurements β€” page 7 of 8
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5 % v/v 45.3 44.33 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10 % v/v 45.3 43.33 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 15 % v/v 45.3 42.0 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20 % v/v 45.3 40.67 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 25 % v/v 45.3 39.33 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30 % v/v 45.3 37.33 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Ethanol 5 % v/v 45.3 43.33 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Ethanol 10 % v/v 45.3 42.0 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Ethanol 15 % v/v 45.3 39.67 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Ethanol 20 % v/v 45.3 37.67 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Ethanol 25 % v/v 45.3 35.33 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Ethanol 30 % v/v 45.3 34.33 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Methanol 5 % v/v 45.3 45.0 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Methanol 10 % v/v 45.3 43.0 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Methanol 15 % v/v 45.3 42.0 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Methanol 20 % v/v 45.3 40.33 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Methanol 25 % v/v 45.3 37.67 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Methanol 30 % v/v 45.3 34.67 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Isopropanol 5 % v/v 45.3 44.0 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
Stability - Tm Melting temperature measured by ThermoFMN in the presence of organic solvent Isopropanol 10 % v/v 45.3 41.33 Β°C Direct Continuous 50 mM sodium phosphate 7.4 β€” β€” β€” β€” β€” Classical aqueous control (in Β°C)
1 … 5 6 7 8

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Tm

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*