Protease from Pseudomonas aeruginosa

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 498 amino acids
MKKVSTLDLLFVAIMGVSPAAFAADLIDVSKLPSKAAQGAPGPVTLQAAVGAGGADELKAIRSTTLPNGKQVTRYEQFHNGVRVVGEAITEVKGPGKSVAARRSGHFVANIAADLPGSTTAAVSAEQVLAQAKSLKAQGRKTENDKVELVIRLGENNIAQLVYNVSYLIPGEGLSRPHFVIDAKTGEVLDQWEGLAHAEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNGSTNDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFNLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVISSAQNRNYSAADVTRAFSTVGVTCPSAL
Anshu Gupta et al. (2005) β€” Purification and characterization of a solvent stable protease from Pseudomonas aeruginosa PseA
Journal of Chromatography A  Β· doi:10.1016/j.chroma.2005.01.080 β†—  Β· Stability - Incubation
7 measurements
Database ID
UniProt: Q3Y6H8 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, bacterium Pseudomonas aeruginosa

Experimental Data (7 measurements)

7 measurements
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (72 hours at 30Β°C), measured by absorbance spectrophotometry (free aromatic residues absorbance measurement, 280 nm) in aqueous phase Benzene 25 % v/v 100 115 % Digital Continuous Incubation: 0.1M Tris-HCl buffer, Assay: 0.1M Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 0.6% Casein free amino acids , Peptides β€” 160 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (72 hours at 30Β°C), measured by absorbance spectrophotometry (free aromatic residues absorbance measurement, 280 nm) in aqueous phase Toluene 25 % v/v 100 111 % Digital Continuous Incubation: 0.1M Tris-HCl buffer, Assay: 0.1M Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 0.6% Casein free amino acids , Peptides β€” 160 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (72 hours at 30Β°C), measured by absorbance spectrophotometry (free aromatic residues absorbance measurement, 280 nm) in aqueous phase n-Hexane 25 % v/v 100 108 % Digital Continuous Incubation: 0.1M Tris-HCl buffer, Assay: 0.1M Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 0.6% Casein free amino acids , Peptides β€” 160 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (72 hours at 30Β°C), measured by absorbance spectrophotometry (free aromatic residues absorbance measurement, 280 nm) in aqueous phase Cyclohexane 25 % v/v 100 104 % Digital Continuous Incubation: 0.1M Tris-HCl buffer, Assay: 0.1M Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 0.6% Casein free amino acids , Peptides β€” 160 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (72 hours at 30Β°C), measured by absorbance spectrophotometry (free aromatic residues absorbance measurement, 280 nm) in aqueous phase n-Heptane 25 % v/v 100 79 % Digital Continuous Incubation: 0.1M Tris-HCl buffer, Assay: 0.1M Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 0.6% Casein free amino acids , Peptides β€” 160 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (72 hours at 30Β°C), measured by absorbance spectrophotometry (free aromatic residues absorbance measurement, 280 nm) in aqueous phase 1-Butanol 25 % v/v 100 67 % Digital Continuous Incubation: 0.1M Tris-HCl buffer, Assay: 0.1M Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 0.6% Casein free amino acids , Peptides β€” 160 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase
Stability - Incubation Activity after incubation (72 hours at 30Β°C), measured by absorbance spectrophotometry (free aromatic residues absorbance measurement, 280 nm) in aqueous phase Isooctane 25 % v/v 100 64 % Digital Continuous Incubation: 0.1M Tris-HCl buffer, Assay: 0.1M Tris-HCl buffer Incubation: 8, Assay: 8 Incubation: 30Β°C, Assay: 60Β°C 0.6% Casein free amino acids , Peptides β€” 160 rpm Non-incubated control (in %), assay in aqueous phase | Uncertainty about whether the assay really was in aqueous phase

Visualization : Stability β€” Incubation

Anshu Gupta et al. (2005)

One bar per measurement. Colour = solvent, shade = solvent volume.

Anshu Gupta et al. (2006) β€” A protease stable in organic solvents from solvent tolerant strain of Pseudomonas aeruginosa
Bioresource Technology  Β· doi:10.1016/j.biortech.2005.09.006 β†—  Β· Stability - Incubation
21 measurements

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*