Feruloyl esterase B (gene fae-1) from Neurospora crassa

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 292 amino acids
MLPRTLLGLALTAATGLCASLQQVTNWGSNPTNIRMYTYVPDKLATKPAIIVALHGCGGTAPSWYSGTRLPSYADQYGFILIYPGTPNMSNCWGVNDPASLTHGAGGDSLGIVAMVNYTIAKYNADASRVYVMGTSSGGMMTNVMAATYPEVFEAGAAYSGVAHACFAGAASATPFSPNQTCARGLQHTPEEWGNFVRNSYPGYTGRRPRMQIYHGLADNLVYPRCAMEALKQWSNVLGVEFSRNVSGVPSQAYTQIVYGDGSKLVGYMGAGVGHVAPTNEQVMLKFFGLIN
Craig B. Faulds et al. (2011) β€” Influence of organic co-solvents on the activity and substrate specificity of feruloyl esterases
Bioresource Technology  Β· doi:10.1016/j.biortech.2011.01.088 β†—  Β· Activity - Classical Stability - C50 Stability - Incubation Activity + Stability - Incubation
63 measurements
Database ID
UniProt: Q9HGR3 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host yeast Pichia pastoris

Experimental Data (63 measurements)

63 measurements β€” page 3 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 5 % v/v 100.0 75.0 % Digital Continuous 100 mM MOPS 6 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 1 % v/v 100.0 68.0 % Digital Continuous 100 mM MOPS 6 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent 1,4-Dioxane 30 % v/v 100.0 0.0 % Digital Continuous 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent 1,4-Dioxane 25 % v/v 100.0 0.0 % Digital Continuous 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent 1,4-Dioxane 20 % v/v 100.0 0.0 % Digital Continuous 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent 1,4-Dioxane 15 % v/v 100.0 5.0 % Digital Continuous 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent 1,4-Dioxane 10 % v/v 100.0 12.0 % Digital Continuous 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent Acetone 20 % v/v 100.0 5.0 % Digital Continuous 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent 1,4-Dioxane 1 % v/v 100.0 66.0 % Digital Continuous 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Classical aqueous control (in %)
Activity - Classical Activity measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent Acetone 25 % v/v 100.0 0.0 % Digital Continuous 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Classical aqueous control (in %)
Activity + Stability - Incubation Activity after incubation (96 hours at 37Β°C) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10 % v/v 4.66 3.48 U/mg Direct Continuous Incubation: 100 mM MOPS, Assay: 100 mM MOPS Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Non-incubated control (in U/mg), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent and control in aqueous phase
Activity + Stability - Incubation Activity after incubation (96 hours at 37Β°C) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent Acetone 10 % v/v 4.66 3.29 U/mg Direct Continuous Incubation: 100 mM MOPS, Assay: 100 mM MOPS Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Non-incubated control (in U/mg), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent and control in aqueous phase
Activity + Stability - Incubation Activity after incubation (96 hours at 37Β°C) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10 % v/v 42.12 28.88 U/mg Direct Continuous Incubation: 100 mM MOPS, Assay: 100 mM MOPS Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Non-incubated control (in U/mg), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent and control in aqueous phase
Activity + Stability - Incubation Activity after incubation (96 hours at 37Β°C) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Acetone 10 % v/v 42.12 23.31 U/mg Direct Continuous Incubation: 100 mM MOPS, Assay: 100 mM MOPS Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Non-incubated control (in U/mg), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent and control in aqueous phase
Stability - C50 Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Acetone β€” β€” 22.0 % (v/v) Direct Continuous 100 mM MOPS 6 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Not applicable control (in % (v/v))
Stability - C50 Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent 1,4-Dioxane β€” β€” 3.0 % (v/v) Direct Continuous 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Not applicable control (in % (v/v))
Stability - C50 Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent Acetone β€” β€” 4.0 % (v/v) Direct Continuous 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Not applicable control (in % (v/v))
Stability - C50 Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) β€” β€” 34.0 % (v/v) Direct Continuous 100 mM MOPS 6 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Not applicable control (in % (v/v))
Stability - C50 Concentration (in % v/v) for which 50% of enzyme activity is lost, as measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) β€” β€” 10.0 % (v/v) Direct Continuous 100 mM MOPS 6 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Not applicable control (in % (v/v))
Stability - Incubation Activity after incubation (96 hours at 37Β°C) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10 % v/v 4.41 3.48 U/mg Direct Continuous Incubation: 100 mM MOPS, Assay: 100 mM MOPS Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Non-incubated control (in U/mg) in the presence of organic solvent (1 minute incubation, 5% DMSO), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent and control in the presence of organic solvent
1 2 3 4

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” C50

One bar per measurement. Colour = solvent, shade = temperature. Hover for details.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*