Feruloyl esterase B (gene fae-1) from Neurospora crassa

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 292 amino acids
MLPRTLLGLALTAATGLCASLQQVTNWGSNPTNIRMYTYVPDKLATKPAIIVALHGCGGTAPSWYSGTRLPSYADQYGFILIYPGTPNMSNCWGVNDPASLTHGAGGDSLGIVAMVNYTIAKYNADASRVYVMGTSSGGMMTNVMAATYPEVFEAGAAYSGVAHACFAGAASATPFSPNQTCARGLQHTPEEWGNFVRNSYPGYTGRRPRMQIYHGLADNLVYPRCAMEALKQWSNVLGVEFSRNVSGVPSQAYTQIVYGDGSKLVGYMGAGVGHVAPTNEQVMLKFFGLIN
Craig B. Faulds et al. (2011) β€” Influence of organic co-solvents on the activity and substrate specificity of feruloyl esterases
Bioresource Technology  Β· doi:10.1016/j.biortech.2011.01.088 β†—  Β· Activity - Classical Stability - C50 Stability - Incubation Activity + Stability - Incubation
63 measurements
Database ID
UniProt: Q9HGR3 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Recombinant, host yeast Pichia pastoris

Experimental Data (63 measurements)

63 measurements β€” page 4 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (96 hours at 37Β°C) measured by absorbance spectrophotometry (ferulic acid absorbance measurement, 335 nm) in the presence of organic solvent Acetone 10 % v/v 4.35 3.29 U/mg Direct Continuous Incubation: 100 mM MOPS, Assay: 100 mM MOPS Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 60 Β΅M Methyl ferulate Ferulic acid , Methanol β€” β€” Non-incubated control (in U/mg) in the presence of organic solvent (1 minute incubation, 5% acetone), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent and control in the presence of organic solvent
Stability - Incubation Activity after incubation (96 hours at 37Β°C) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10 % v/v 36.7 28.88 U/mg Direct Continuous Incubation: 100 mM MOPS, Assay: 100 mM MOPS Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Non-incubated control (in U/mg) in the presence of organic solvent (1 minute incubation, 5% DMSO), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent and control in the presence of organic solvent
Stability - Incubation Activity after incubation (96 hours at 37Β°C) measured by absorbance spectrophotometry (p-coumaric acid absorbance measurement, 335 nm) in the presence of organic solvent Acetone 10 % v/v 39.4 23.31 U/mg Direct Continuous Incubation: 100 mM MOPS, Assay: 100 mM MOPS Incubation: 6, Assay: 6 Incubation: 37Β°C, Assay: 37Β°C 60 Β΅M Methyl p-coumarate Methanol , p-Coumaric acid β€” β€” Non-incubated control (in U/mg) in the presence of organic solvent (1 minute incubation, 5% acetone), assay in the presence of organic solvent | Clear about assay in the presence of organic solvent and control in the presence of organic solvent
1 2 3 4
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity + Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” C50

One bar per measurement. Colour = solvent, shade = temperature. Hover for details.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*