Esterase PHE21 from Pseudomonas oryzihabitans HUP022

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 321 amino acids
MPDVFARLTPEVAGLLAQLAAHPQPPLDSLTPAQARAAYVQLNRALGLPPAPVKRVEALSAPGPLGPIPLRLYRPYAEDDRPRPLVIYLHGGGWVIGDLDSHDSLCRQIAIGTGYAVLAVHYALAPEHPAPASPDDVLAALHWLAEAGSAFHLDLDRIAVAGDSAGGGLAAMAALYLREGPLRLKAQVLIYPGVDNTPEAWNHPSRIENAQVPPLTRPMMDYFSGMYLQDVDTRDPRVSPLYAASHADLPPALIFGAECDALRDDARLYAQALIGAGNAVEYHELPGMIHGFIEMLGVLPSVRWTLARMNAFLREHLQQAA
Yilong Wang et al. (2016) β€” Functional Characterization of a Robust Marine Microbial Esterase and Its Utilization in the Stereo-Selective Preparation of Ethyl (S)-3-Hydroxybutyrate
Applied Biochemistry and Biotechnology  Β· doi:10.1007/s12010-016-2161-1 β†—  Β· Stability - Incubation Activity + Stability - Conversion Selectivity - Enantioselectivity
51 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (51 measurements)

51 measurements β€” page 1 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity + Stability - Conversion Conversion after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC Cyclohexanone 10 % v/v 51.0 28.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Activity + Stability - Conversion Conversion after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC Dimethylformamide (DMF) 10 % v/v 51.0 26.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Activity + Stability - Conversion Conversion after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC Isooctane 10 % v/v 51.0 34.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Activity + Stability - Conversion Conversion after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC n-Hexane 10 % v/v 51.0 28.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Activity + Stability - Conversion Conversion after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC Tetrahydrofuran (THF) 10 % v/v 51.0 34.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Activity + Stability - Conversion Conversion after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC Chloroform 10 % v/v 51.0 37.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Activity + Stability - Conversion Conversion after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC Acetonitrile 10 % v/v 51.0 46.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Activity + Stability - Conversion Conversion after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC Methanol 10 % v/v 51.0 34.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Activity + Stability - Conversion Conversion after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC Toluene 10 % v/v 51.0 23.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Activity + Stability - Conversion Conversion after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC Dimethyl Sulfoxide (DMSO) 10 % v/v 51.0 36.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Activity + Stability - Conversion Conversion after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC Cyclohexane 10 % v/v 51.0 36.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Activity + Stability - Conversion Conversion after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC 1-Pentanol 10 % v/v 51.0 28.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Activity + Stability - Conversion Conversion after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC 1-Butanol 10 % v/v 51.0 32.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric excess (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ([S]-[R])/([S]+[R]) Dimethylformamide (DMF) 10 % v/v 69.0 13.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric ratio (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ln((1-C)(1-ees))/ln((1+C)(1+ees)) Toluene 10 % v/v 9.63 12.75 enantiomeric ratio Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in enantiomeric ratio) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric ratio (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ln((1-C)(1-ees))/ln((1+C)(1+ees)) Dimethyl Sulfoxide (DMSO) 10 % v/v 9.63 10.27 enantiomeric ratio Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in enantiomeric ratio) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric excess (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ([S]-[R])/([S]+[R]) 1-Butanol 10 % v/v 69.0 32.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric excess (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ([S]-[R])/([S]+[R]) 1-Pentanol 10 % v/v 69.0 26.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric excess (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ([S]-[R])/([S]+[R]) Cyclohexanone 10 % v/v 69.0 5.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric excess (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ([S]-[R])/([S]+[R]) Cyclohexane 10 % v/v 69.0 16.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
β€Ή Prev
1 2 3

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity + Stability β€” Conversion

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Selectivity - Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*