Esterase PHE21 from Pseudomonas oryzihabitans HUP022

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 321 amino acids
MPDVFARLTPEVAGLLAQLAAHPQPPLDSLTPAQARAAYVQLNRALGLPPAPVKRVEALSAPGPLGPIPLRLYRPYAEDDRPRPLVIYLHGGGWVIGDLDSHDSLCRQIAIGTGYAVLAVHYALAPEHPAPASPDDVLAALHWLAEAGSAFHLDLDRIAVAGDSAGGGLAAMAALYLREGPLRLKAQVLIYPGVDNTPEAWNHPSRIENAQVPPLTRPMMDYFSGMYLQDVDTRDPRVSPLYAASHADLPPALIFGAECDALRDDARLYAQALIGAGNAVEYHELPGMIHGFIEMLGVLPSVRWTLARMNAFLREHLQQAA
Yilong Wang et al. (2016) β€” Functional Characterization of a Robust Marine Microbial Esterase and Its Utilization in the Stereo-Selective Preparation of Ethyl (S)-3-Hydroxybutyrate
Applied Biochemistry and Biotechnology  Β· doi:10.1007/s12010-016-2161-1 β†—  Β· Stability - Incubation Activity + Stability - Conversion Selectivity - Enantioselectivity
51 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (51 measurements)

51 measurements β€” page 3 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (12 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Hexane 10 % v/v 100.0 95.21 % Direct Continuous Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer, 1% acetonitrile, 4% Ethanol Incubation: 7.5, Assay: 7.5 Incubation: 4Β°C, Assay: 35Β°C 0.1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (12 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1-Butanol 10 % v/v 100.0 108.81 % Direct Continuous Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer, 1% acetonitrile, 4% Ethanol Incubation: 7.5, Assay: 7.5 Incubation: 4Β°C, Assay: 35Β°C 0.1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (12 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1-Decanol 10 % v/v 100.0 94.4 % Direct Continuous Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer, 1% acetonitrile, 4% Ethanol Incubation: 7.5, Assay: 7.5 Incubation: 4Β°C, Assay: 35Β°C 0.1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (12 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Isopropanol 10 % v/v 100.0 78.73 % Direct Continuous Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer, 1% acetonitrile, 4% Ethanol Incubation: 7.5, Assay: 7.5 Incubation: 4Β°C, Assay: 35Β°C 0.1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (12 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Dimethyl Sulfoxide (DMSO) 10 % v/v 100.0 82.81 % Direct Continuous Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer, 1% acetonitrile, 4% Ethanol Incubation: 7.5, Assay: 7.5 Incubation: 4Β°C, Assay: 35Β°C 0.1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (12 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Chloroform 10 % v/v 100.0 112.89 % Direct Continuous Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer, 1% acetonitrile, 4% Ethanol Incubation: 7.5, Assay: 7.5 Incubation: 4Β°C, Assay: 35Β°C 0.1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (12 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Tetrahydrofuran (THF) 10 % v/v 100.0 110.87 % Direct Continuous Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer, 1% acetonitrile, 4% Ethanol Incubation: 7.5, Assay: 7.5 Incubation: 4Β°C, Assay: 35Β°C 0.1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (12 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Toluene 10 % v/v 100.0 106.43 % Direct Continuous Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer, 1% acetonitrile, 4% Ethanol Incubation: 7.5, Assay: 7.5 Incubation: 4Β°C, Assay: 35Β°C 0.1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (12 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase 1-Pentanol 10 % v/v 100.0 144.98 % Direct Continuous Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer, 1% acetonitrile, 4% Ethanol Incubation: 7.5, Assay: 7.5 Incubation: 4Β°C, Assay: 35Β°C 0.1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (12 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase n-Decane 10 % v/v 100.0 87.99 % Direct Continuous Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer, 1% acetonitrile, 4% Ethanol Incubation: 7.5, Assay: 7.5 Incubation: 4Β°C, Assay: 35Β°C 0.1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
Stability - Incubation Activity after incubation (12 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Methanol 10 % v/v 100.0 102.64 % Direct Continuous Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer, 1% acetonitrile, 4% Ethanol Incubation: 7.5, Assay: 7.5 Incubation: 4Β°C, Assay: 35Β°C 0.1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
1 2 3
Next β€Ί

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity + Stability β€” Conversion

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Selectivity - Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*