Esterase PHE21 from Pseudomonas oryzihabitans HUP022

Enzyme Description

Extremophile
No
EC Number

Sequence

Length: 321 amino acids
MPDVFARLTPEVAGLLAQLAAHPQPPLDSLTPAQARAAYVQLNRALGLPPAPVKRVEALSAPGPLGPIPLRLYRPYAEDDRPRPLVIYLHGGGWVIGDLDSHDSLCRQIAIGTGYAVLAVHYALAPEHPAPASPDDVLAALHWLAEAGSAFHLDLDRIAVAGDSAGGGLAAMAALYLREGPLRLKAQVLIYPGVDNTPEAWNHPSRIENAQVPPLTRPMMDYFSGMYLQDVDTRDPRVSPLYAASHADLPPALIFGAECDALRDDARLYAQALIGAGNAVEYHELPGMIHGFIEMLGVLPSVRWTLARMNAFLREHLQQAA
Yilong Wang et al. (2016) β€” Functional Characterization of a Robust Marine Microbial Esterase and Its Utilization in the Stereo-Selective Preparation of Ethyl (S)-3-Hydroxybutyrate
Applied Biochemistry and Biotechnology  Β· doi:10.1007/s12010-016-2161-1 β†—  Β· Stability - Incubation Activity + Stability - Conversion Selectivity - Enantioselectivity
51 measurements
Database ID
Sequence Annotation
Explicit - Provided GenBank Accession Number
Protein Source
Recombinant, host bacterium Escherichia coli BL21 (DE3)

Experimental Data (51 measurements)

51 measurements β€” page 2 of 3
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Selectivity - Enantioselectivity Enantiomeric excess (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ([S]-[R])/([S]+[R]) Dimethyl Sulfoxide (DMSO) 10 % v/v 69.0 42.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric ratio (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ln((1-C)(1-ees))/ln((1+C)(1+ees)) Methanol 10 % v/v 9.63 91.01 enantiomeric ratio Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in enantiomeric ratio) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric ratio (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ln((1-C)(1-ees))/ln((1+C)(1+ees)) Acetonitrile 10 % v/v 9.63 7.8 enantiomeric ratio Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in enantiomeric ratio) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric ratio (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ln((1-C)(1-ees))/ln((1+C)(1+ees)) Chloroform 10 % v/v 9.63 2.8 enantiomeric ratio Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in enantiomeric ratio) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric ratio (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ln((1-C)(1-ees))/ln((1+C)(1+ees)) Tetrahydrofuran (THF) 10 % v/v 9.63 3.04 enantiomeric ratio Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in enantiomeric ratio) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric ratio (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ln((1-C)(1-ees))/ln((1+C)(1+ees)) n-Hexane 10 % v/v 9.63 6.17 enantiomeric ratio Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in enantiomeric ratio) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric ratio (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ln((1-C)(1-ees))/ln((1+C)(1+ees)) Isooctane 10 % v/v 9.63 11.43 enantiomeric ratio Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in enantiomeric ratio) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric ratio (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ln((1-C)(1-ees))/ln((1+C)(1+ees)) Dimethylformamide (DMF) 10 % v/v 9.63 2.41 enantiomeric ratio Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in enantiomeric ratio) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric ratio (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ln((1-C)(1-ees))/ln((1+C)(1+ees)) Cyclohexane 10 % v/v 9.63 2.08 enantiomeric ratio Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in enantiomeric ratio) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric ratio (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ln((1-C)(1-ees))/ln((1+C)(1+ees)) Cyclohexanone 10 % v/v 9.63 1.35 enantiomeric ratio Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in enantiomeric ratio) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric ratio (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ln((1-C)(1-ees))/ln((1+C)(1+ees)) 1-Pentanol 10 % v/v 9.63 10.47 enantiomeric ratio Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in enantiomeric ratio) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric ratio (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ln((1-C)(1-ees))/ln((1+C)(1+ees)) 1-Butanol 10 % v/v 9.63 6.96 enantiomeric ratio Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in enantiomeric ratio) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric excess (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ([S]-[R])/([S]+[R]) n-Hexane 10 % v/v 69.0 26.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric excess (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ([S]-[R])/([S]+[R]) Tetrahydrofuran (THF) 10 % v/v 69.0 22.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric excess (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ([S]-[R])/([S]+[R]) Chloroform 10 % v/v 69.0 22.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric excess (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ([S]-[R])/([S]+[R]) Acetonitrile 10 % v/v 69.0 54.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric excess (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ([S]-[R])/([S]+[R]) Methanol 10 % v/v 69.0 50.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric excess (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ([S]-[R])/([S]+[R]) Toluene 10 % v/v 69.0 24.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Selectivity - Enantioselectivity Enantiomeric excess (toward s form) after incubation in the presence of organic solvent (2 hours at 40Β°C) measured by GC and computed as ([S]-[R])/([S]+[R]) Isooctane 10 % v/v 69.0 40.0 % Direct Continuous 50 mM phosphate buffer 8 40Β°C 50 mM Ethyl 3-hydroxybutyrate 3-Hydroxybutyric Acid , Ethanol β€” β€” Classical aqueous control (in %) | Uncertainty about organic solvent concentration
Stability - Incubation Activity after incubation (12 hours at 4Β°C), measured by absorbance spectrophotometry (p-nitrophenol absorbance measurement, 405 nm) in aqueous phase Ethanol 10 % v/v 100.0 84.59 % Direct Continuous Incubation: 50 mM phosphate buffer, Assay: 50 mM phosphate buffer, 1% acetonitrile, 4% Ethanol Incubation: 7.5, Assay: 7.5 Incubation: 4Β°C, Assay: 35Β°C 0.1 mM p-Nitrophenyl butyrate Butyric Acid , p-Nitrophenol β€” β€” Non-incubated control (in %), assay measured in aqueous phase | Uncertainty about whether assay in aqueous phase or in the presence of organic solvent, uncertainty about control
1 2 3

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Activity + Stability β€” Conversion

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Selectivity - Enantioselectivity

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*