NAD-dependent glutamate dehydrogenase from Pyrobaculum islandicum

Enzyme Description

Extremophile
Yes "hyperthermophilic" organism
EC Number

Sequence

Length: 421 amino acids
MERTGFLEYVLNYVKKGVELGGFPEDFYKILSRPRRVLIVNIPVRLDGGGFEVFEGYRVQHCDVLGPYKGGVRFHPEVTLADDVALAILMTLKNSLAGLPYGGAKGAVRVDPKKLSQRELEELSRGYARAIAPLIGDVVDIPAPDVGTNAQIMAWMVDEYSKIKGYNVPGVFTSKPPELWGNPVREYATGFGVAVATREMAKKLWGGIEGKTVAIQGMGNVGRWTAYWLEKMGAKVIAVSDINGVAYRKEGLNVELIQKNKGLTGPALVELFTTKDNAEFVKNPDAIFKLDVDIFVPAAIENVIRGDNAGLVKARLVVEGANGPTTPEAERILYERGVVVVPDILANAGGVIMSYLEWVENLQWYIWDEEETRKRLENIMVNNVERVYKRWQREKGWTMRDAAIVTALERIYNAMKIRGWI
Chizu Kujo et al. (1998) β€” Enzymological Characteristics of the Hyperthermostable NAD-Dependent Glutamate Dehydrogenase from the Archaeon Pyrobaculum islandicum and Effects of Denaturants and Organic Solvents
Applied and Environmental Microbiology  Β· doi:10.1128/aem.64.6.2152-2157.1998 β†—  Β· Activity - Classical Stability - Incubation
67 measurements
Database ID
UniProt: Q9Y8I4 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, archaeon Pyrobaculum islandicum

Experimental Data (67 measurements)

67 measurements β€” page 1 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethylformamide (DMF) 40 % v/v 100 110 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Tetrahydrofuran (THF) 5 % v/v 100 217 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Tetrahydrofuran (THF) 10 % v/v 100 228 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Tetrahydrofuran (THF) 15 % v/v 100 162 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Tetrahydrofuran (THF) 20 % v/v 100 38 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Tetrahydrofuran (THF) 30 % v/v 100 0 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethylformamide (DMF) 10 % v/v 100 140 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethylformamide (DMF) 20 % v/v 100 158 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethylformamide (DMF) 30 % v/v 100 145 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 20 % v/v 100 196 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethylformamide (DMF) 50 % v/v 100 49 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethylformamide (DMF) 60 % v/v 100 0 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 10 % v/v 100 76 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 20 % v/v 100 61 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 30 % v/v 100 46 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 40 % v/v 100 22 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 50 % v/v 100 19 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Dimethyl Sulfoxide (DMSO) 60 % v/v 100 0 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 25 % v/v 100 46 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 30 % v/v 100 0 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
β€Ή Prev
1 2 3 4

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*