NAD-dependent glutamate dehydrogenase from Pyrobaculum islandicum

Enzyme Description

Extremophile
Yes "hyperthermophilic" organism
EC Number

Sequence

Length: 421 amino acids
MERTGFLEYVLNYVKKGVELGGFPEDFYKILSRPRRVLIVNIPVRLDGGGFEVFEGYRVQHCDVLGPYKGGVRFHPEVTLADDVALAILMTLKNSLAGLPYGGAKGAVRVDPKKLSQRELEELSRGYARAIAPLIGDVVDIPAPDVGTNAQIMAWMVDEYSKIKGYNVPGVFTSKPPELWGNPVREYATGFGVAVATREMAKKLWGGIEGKTVAIQGMGNVGRWTAYWLEKMGAKVIAVSDINGVAYRKEGLNVELIQKNKGLTGPALVELFTTKDNAEFVKNPDAIFKLDVDIFVPAAIENVIRGDNAGLVKARLVVEGANGPTTPEAERILYERGVVVVPDILANAGGVIMSYLEWVENLQWYIWDEEETRKRLENIMVNNVERVYKRWQREKGWTMRDAAIVTALERIYNAMKIRGWI
Chizu Kujo et al. (1998) β€” Enzymological Characteristics of the Hyperthermostable NAD-Dependent Glutamate Dehydrogenase from the Archaeon Pyrobaculum islandicum and Effects of Denaturants and Organic Solvents
Applied and Environmental Microbiology  Β· doi:10.1128/aem.64.6.2152-2157.1998 β†—  Β· Activity - Classical Stability - Incubation
67 measurements
Database ID
UniProt: Q9Y8I4 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, archaeon Pyrobaculum islandicum

Experimental Data (67 measurements)

67 measurements β€” page 2 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 10 % v/v 100 185 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 30 % v/v 100 190 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 40 % v/v 100 189 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 50 % v/v 100 159 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Ethanol 60 % v/v 100 49 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 10 % v/v 100 76 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 20 % v/v 100 60 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 40 % v/v 100 22 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 50 % v/v 100 19 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 60 % v/v 100 0 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 5 % v/v 100 172 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 10 % v/v 100 221 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 15 % v/v 100 240 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Acetonitrile 20 % v/v 100 194 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Activity - Classical Activity assayd by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in the presence of organic solvent Methanol 30 % v/v 100 46 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Classical aqueous control (in %)
Stability - Incubation Activity after incubation (10 minutes at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase Acetonitrile 50 % v/v 100 30 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (10 minutes at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase Tetrahydrofuran (THF) 10 % v/v 100 108 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (10 minutes at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase Tetrahydrofuran (THF) 20 % v/v 100 83 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (10 minutes at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase Tetrahydrofuran (THF) 30 % v/v 100 0 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (10 minutes at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase Dimethylformamide (DMF) 10 % v/v 100 107 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Non-incubated control (in %), assay in aqueous phase
1 2 3 4

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*