NAD-dependent glutamate dehydrogenase from Pyrobaculum islandicum

Enzyme Description

Extremophile
Yes "hyperthermophilic" organism
EC Number

Sequence

Length: 421 amino acids
MERTGFLEYVLNYVKKGVELGGFPEDFYKILSRPRRVLIVNIPVRLDGGGFEVFEGYRVQHCDVLGPYKGGVRFHPEVTLADDVALAILMTLKNSLAGLPYGGAKGAVRVDPKKLSQRELEELSRGYARAIAPLIGDVVDIPAPDVGTNAQIMAWMVDEYSKIKGYNVPGVFTSKPPELWGNPVREYATGFGVAVATREMAKKLWGGIEGKTVAIQGMGNVGRWTAYWLEKMGAKVIAVSDINGVAYRKEGLNVELIQKNKGLTGPALVELFTTKDNAEFVKNPDAIFKLDVDIFVPAAIENVIRGDNAGLVKARLVVEGANGPTTPEAERILYERGVVVVPDILANAGGVIMSYLEWVENLQWYIWDEEETRKRLENIMVNNVERVYKRWQREKGWTMRDAAIVTALERIYNAMKIRGWI
Chizu Kujo et al. (1998) β€” Enzymological Characteristics of the Hyperthermostable NAD-Dependent Glutamate Dehydrogenase from the Archaeon Pyrobaculum islandicum and Effects of Denaturants and Organic Solvents
Applied and Environmental Microbiology  Β· doi:10.1128/aem.64.6.2152-2157.1998 β†—  Β· Activity - Classical Stability - Incubation
67 measurements
Database ID
UniProt: Q9Y8I4 β†—
Sequence Annotation
Inferred - from protein name
Protein Source
Purified, archaeon Pyrobaculum islandicum

Experimental Data (67 measurements)

67 measurements β€” page 4 of 4
Property Assay Solvent Solvent Volume Aqueous Reference Measured Value Units Extraction method Data type Solution pH Temperature Substrate(s) Product(s) Cofactor(s) Shaking Comments
Stability - Incubation Activity after incubation (10 minutes at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase Methanol 10 % v/v 100 100 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (10 minutes at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase Ethanol 60 % v/v 100 0 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (10 minutes at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase Ethanol 50 % v/v 100 24 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (10 minutes at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase Ethanol 40 % v/v 100 101 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (10 minutes at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase Ethanol 30 % v/v 100 124 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (10 minutes at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase Ethanol 20 % v/v 100 122 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Non-incubated control (in %), assay in aqueous phase
Stability - Incubation Activity after incubation (10 minutes at 50Β°C), measured by absorbance spectrophotometry (NADH absorbance measurement, 340 nm) in aqueous phase Ethanol 10 % v/v 100 107 % Digital Continuous 0.2 micoM glycine-KOH buffer 9.7 50Β°C 10 Β΅mol L-glutamic acid NH4+ , Ξ±-ketoglutarate 1.25 Β΅M NAD β€” Non-incubated control (in %), assay in aqueous phase
1 2 3 4
Next β€Ί

Visualization : Activity β€” Classical

One bar per measurement. Colour = solvent, shade = solvent volume.

Visualization : Stability β€” Incubation

One bar per measurement. Colour = solvent, shade = solvent volume.

Structure

Drag to rotate Β· Scroll to zoom Β· Right-click drag to pan Β· Powered by Mol*